Protein Info for ABZR87_RS16945 in Ralstonia sp. UNC404CL21Col

Annotation: organic hydroperoxide resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 138 TIGR03561: peroxiredoxin, Ohr subfamily" amino acids 8 to 136 (129 residues), 166 bits, see alignment E=2.7e-53 PF02566: OsmC" amino acids 40 to 135 (96 residues), 62.7 bits, see alignment E=1.9e-21

Best Hits

Swiss-Prot: 50% identical to OHR_XANCH: Organic hydroperoxide resistance protein (ohr) from Xanthomonas campestris pv. phaseoli

KEGG orthology group: None (inferred from 75% identity to reu:Reut_B5124)

Predicted SEED Role

"Organic hydroperoxide resistance protein" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (138 amino acids)

>ABZR87_RS16945 organic hydroperoxide resistance protein (Ralstonia sp. UNC404CL21Col)
MTRIENVLYTAKVNVTGGRDGQAHSDDDRLNLKLSPPGSSGRGTNPEQLFAAGWSACFIG
AMGRAASQMKIKLPADLALNTEVDLGTTDDAFFLQARLNVSLPGLDRDVAQAVVEAAHQL
CPYSKATRGNIHVELNLV