Protein Info for ABZR87_RS16865 in Ralstonia sp. UNC404CL21Col

Annotation: ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 PF00989: PAS" amino acids 11 to 60 (50 residues), 24.5 bits, see alignment 4.8e-09 TIGR00229: PAS domain S-box protein" amino acids 12 to 73 (62 residues), 25 bits, see alignment E=8.6e-10 PF08448: PAS_4" amino acids 18 to 133 (116 residues), 26.7 bits, see alignment E=1.1e-09 PF02518: HATPase_c" amino acids 329 to 442 (114 residues), 91.3 bits, see alignment E=1.1e-29

Best Hits

KEGG orthology group: None (inferred from 69% identity to bug:BC1001_3610)

Predicted SEED Role

"Sensor histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (461 amino acids)

>ABZR87_RS16865 ATP-binding protein (Ralstonia sp. UNC404CL21Col)
MANITQSQLSEAIAQLVSCGVFSVDREMRFLSWNRFMQYHSGRSGEDVLGRNMFELFPEL
PEKWLRKKIESVFVLGVSAYTSWEHRPYLFRFRHTRPITDTMEWMQQNCSFIPIEDENGV
VIAVGVTLLDATDVCLAYGELRKREKIATDALQELTVRNGQLSALNEELAQAHQQLLQSE
KLAAIGQLAAGIAHEINNPVGFVLSNLNTLQRYLSTLLDYARGMEQLITDAAPSLEGQLA
HLARTADIDYLAEDAPALVSESREGLTRVRDIVVDLRDFSRVDSSHQWEQVDIHRCIEST
LNIVHNEIKYHADLVREYSELPQVTCIPSQVNQVVLNLVVNAAQAYASKQAQGGQRGTIA
VRTGCDADDPKSIWFEVADAGCGIPPENLKRIFDPFFTTKPVGKGTGLGLSLTYGIVKAH
GGRIDVASQVGEGTTFRVVLPLCHESNAPAADQRAGSLAPA