Protein Info for ABZR87_RS15975 in Ralstonia sp. UNC404CL21Col

Annotation: cytochrome b/b6 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 48 to 68 (21 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 137 to 161 (25 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 12 to 179 (168 residues), 92.8 bits, see alignment E=1.2e-30

Best Hits

KEGG orthology group: None (inferred from 91% identity to rpf:Rpic12D_2101)

Predicted SEED Role

"Cytochrome B561"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (185 amino acids)

>ABZR87_RS15975 cytochrome b/b6 domain-containing protein (Ralstonia sp. UNC404CL21Col)
MRRADPPVYAGLPIALHWVSALLLGSLFALGFYMTGLAKGAPGKAALVNLHKSLGLTAAL
VIAWRVVVRVRRAAPPSIPGLHCWETELARITHRLLYMCMVVMPVSGYLGSSFNAYGTRF
WGVPLPRWGWVDSALQHMFYTVHSTTADLLLCLMALHVAGVIKHQWFDAQRCVQRMLPGR
RTRAL