Protein Info for ABZR87_RS15420 in Ralstonia sp. UNC404CL21Col
Annotation: nicotinate-nucleotide adenylyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 41% identical to NADD_BURL3: Probable nicotinate-nucleotide adenylyltransferase (nadD) from Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
KEGG orthology group: K00969, nicotinate-nucleotide adenylyltransferase [EC: 2.7.7.18] (inferred from 98% identity to rpi:Rpic_2391)Predicted SEED Role
"Nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.7.7.18)
MetaCyc Pathways
- aspartate superpathway (23/25 steps found)
- NAD de novo biosynthesis I (6/6 steps found)
- NAD de novo biosynthesis III (6/6 steps found)
- NAD salvage pathway II (PNC IV cycle) (5/5 steps found)
- NAD biosynthesis from 2-amino-3-carboxymuconate semialdehyde (4/4 steps found)
- NAD salvage pathway I (PNC VI cycle) (6/7 steps found)
- NAD de novo biosynthesis IV (anaerobic) (5/6 steps found)
- NAD de novo biosynthesis II (from tryptophan) (7/9 steps found)
- NAD salvage pathway V (PNC V cycle) (4/5 steps found)
- superpathway of NAD biosynthesis in eukaryotes (9/14 steps found)
- NAD salvage (plants) (6/11 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.7.7.18
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (236 amino acids)
>ABZR87_RS15420 nicotinate-nucleotide adenylyltransferase (Ralstonia sp. UNC404CL21Col) MTLPTFVHPDLDRPYRLGLLGGTFDPPHVGHIALAELCIARLDLDELLWIPTGVSWQKAA DITPAPLRFAMTELAAKAVRGGRARVHVSSMEVDRHGPSYTIDTVRDLRGVYGPDTSMAW LMGADQLVGLDTWHGWQDLFEYVHLCVATRPGFDLQALHVPVQRELDVRRGDTALIQCAP AGHMWIDQTLAVDLSSTRLRQQLATGARCDADLPAGVADLIQSHSLYRRANGTVSA