Protein Info for ABZR87_RS15040 in Ralstonia sp. UNC404CL21Col

Annotation: xanthine dehydrogenase small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02963: xanthine dehydrogenase, small subunit
  • amino acids 6 to 484 (479 residues), 700 bits, E=6.5e-215
• PF00111: Fer2
  • amino acids 12 to 61 (50 residues), 24.5 bits, 4.2e-09
• PF01799: Fer2_2
  • amino acids 86 to 162 (77 residues), 98.1 bits, E=5.3e-32
• PF00941: FAD_binding_5
  • amino acids 206 to 369 (164 residues), 145.4 bits, E=3.1e-46
• PF03450: CO_deh_flav_C
  • amino acids 379 to 483 (105 residues), 111.1 bits, E=5.2e-36

Best Hits

KEGG orthology group: K13481, xanthine dehydrogenase small subunit [EC: 1.17.1.4] (inferred from 96% identity to rpi:Rpic_2246)

Predicted SEED Role

"Xanthine dehydrogenase, iron-sulfur cluster and FAD-binding subunit A (1.17.1.4)" in subsystem Purine Utilization

MetaCyc Pathways

• purine nucleotides degradation II (aerobic) (11/11 steps found)
• adenosine nucleotides degradation II (5/5 steps found)
• guanosine nucleotides degradation III (4/4 steps found)
• inosine 5'-phosphate degradation (4/4 steps found)
• ureide biosynthesis (6/7 steps found)
• guanosine nucleotides degradation II (3/4 steps found)
• adenosine nucleotides degradation I (5/8 steps found)
• guanosine nucleotides degradation I (2/4 steps found)
• purine nucleobases degradation II (anaerobic) (16/24 steps found)
• superpathway of guanosine nucleotides degradation (plants) (3/6 steps found)
• purine nucleotides degradation I (plants) (7/12 steps found)
• superpathway of purines degradation in plants (11/18 steps found)
• caffeine degradation III (bacteria, via demethylation) (1/7 steps found)
• theophylline degradation (1/9 steps found)
• caffeine degradation IV (bacteria, via demethylation and oxidation) (1/10 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.17.1.4

Use Curated BLAST to search for 1.17.1.4

Protein Sequence (508 amino acids)

>ABZR87_RS15040 xanthine dehydrogenase small subunit (Ralstonia sp. UNC404CL21Col)
METQPIRFFHRGQVRTVTDAPITRTVLQYLREDAHCTGTKEGCAEGDCGACTVVLGELQE
DGSVGLKAVNACIQFLPTLDGKALFTVEDVRGKDGTLHPVQEAMVECHGSQCGFCTPGFV
MSLYALYENTGNQAPIPSRQTICDSLTGNLCRCTGYRPIIDAGERMFELPAPAGIDRTQL
AETLRKLQRNDTFSYAPVGTENAPRFYAPRTASAFAAIKAAHPNIRILAGSTDVGLWVTK
QFRDLGDILYIGQVADLYALEKRDGWIEIGAAVSLEKAYAFLAADYPEVTELWKRFASLP
IRNAGTLGGNIANGSPIGDSAPALIAIGTRVVLQRGEVRRELPLEDLYLAYQKNAMEEGE
FVAGLRIPAREGRDALRFRTYKLSKRFDEDISAVCAALAIELDSQDGETRVRSARIAYGG
MAATSKRATETENAIVGQPWNEATVRAAMAAMSRDYTPLTDMRATDNYRRISAANTVYRF
WLETRVDAPLTPEQINVRAVELNTLTAA