Protein Info for ABZR87_RS14975 in Ralstonia sp. UNC404CL21Col

Annotation: RDD family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 transmembrane" amino acids 33 to 53 (21 residues), see Phobius details amino acids 65 to 81 (17 residues), see Phobius details amino acids 111 to 130 (20 residues), see Phobius details amino acids 136 to 155 (20 residues), see Phobius details PF06271: RDD" amino acids 20 to 168 (149 residues), 73 bits, see alignment E=1.5e-24

Best Hits

KEGG orthology group: None (inferred from 94% identity to rpi:Rpic_2232)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (174 amino acids)

>ABZR87_RS14975 RDD family protein (Ralstonia sp. UNC404CL21Col)
MATSASSTSPVATPDPLTAPTLRRRLAAMLYEGLLLFGVMFGATAVFLLLRLIVPPLART
GDVGLQVWGFLALGLYFVWFWRKRGQTLAMQTWRMRVVNADGSRISLGRAVARYLLAWVW
VATAVGVIHLSGASRWAGAGVALACLLAWGALAWLDPQRQFLHDRLAGTRLVRD