Protein Info for ABZR87_RS14930 in Ralstonia sp. UNC404CL21Col

Annotation: 2-isopropylmalate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 513 TIGR00973: 2-isopropylmalate synthase" amino acids 4 to 499 (496 residues), 706.4 bits, see alignment E=8.1e-217 PF00682: HMGL-like" amino acids 5 to 274 (270 residues), 329.8 bits, see alignment E=1.8e-102 PF22617: HCS_D2" amino acids 288 to 369 (82 residues), 98.5 bits, see alignment E=3.6e-32 PF08502: LeuA_dimer" amino acids 371 to 501 (131 residues), 117.5 bits, see alignment E=5.8e-38

Best Hits

Swiss-Prot: 99% identical to LEU11_RALSO: 2-isopropylmalate synthase 1 (leuA1) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K01649, 2-isopropylmalate synthase [EC: 2.3.3.13] (inferred from 98% identity to rsc:RCFBP_11317)

Predicted SEED Role

"2-isopropylmalate synthase (EC 2.3.3.13)" in subsystem Branched-Chain Amino Acid Biosynthesis or Leucine Biosynthesis (EC 2.3.3.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.3.13

Use Curated BLAST to search for 2.3.3.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (513 amino acids)

>ABZR87_RS14930 2-isopropylmalate synthase (Ralstonia sp. UNC404CL21Col)
MSDKLIIFDTTLRDGEQSPGASMTKEEKIRIAKQLERLKVDVIEAGFAASSNGDFEAIRA
IAQSVKDSRICSLARANDRDISRAAEALKPAGQFRIHTFIATSALHMEKKLRMSPDQVYE
QARLAVRFARQFTDDIEFSPEDGSRSDMDFLCRVLEGVIAEGATTINLPDTVGYAVPEGY
AALIRSVRERIPNSDKAIWSVHCHDDLGMAVANSLTAVQLGGARQIECTINGLGERAGNT
SLEEVVMAVKTRRDYFNLDVGVDTSQIVPASKLVSQITGFVVQPNKAVVGANAFAHASGI
HQDGVLKARDTYEIMRAEDVGWTANKIVLGKLSGRNAFKQRLQELGIELDSEAELNAAFT
RFKELADQKAEIFDEDIVAIVSNEAQHSEGEHFRFVSLAQRSETGERPHARIVFVADGKE
VTGEAEGNGPVDATLNAIESKVASGAEQLLYSVNAITTGTQAQGEVTVRLSKSGRIVNGV
GTDPDIVAASAKAYLAALNKLQDKSSEKLNPQI