Protein Info for ABZR87_RS14880 in Ralstonia sp. UNC404CL21Col
Annotation: NADH-quinone oxidoreductase subunit A
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to NUOA_RALPJ: NADH-quinone oxidoreductase subunit A (nuoA) from Ralstonia pickettii (strain 12J)
KEGG orthology group: K00330, NADH dehydrogenase I subunit A [EC: 1.6.5.3] (inferred from 97% identity to rsc:RCFBP_11326)MetaCyc: 37% identical to ferredoxin-plastoquinone oxidoreductase subunit C (Synechococcus elongatus PCC 7942 = FACHB-805)
Predicted SEED Role
"NADH ubiquinone oxidoreductase chain A (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)
MetaCyc Pathways
- NADH to cytochrome bo oxidase electron transfer I (2/2 steps found)
- aerobic respiration I (cytochrome c) (3/4 steps found)
- aerobic respiration III (alternative oxidase pathway) (2/3 steps found)
- NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
- NAD(P)/NADPH interconversion (3/6 steps found)
- Fe(II) oxidation (2/6 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 1.6.5.3
Use Curated BLAST to search for 1.6.5.3
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (119 amino acids)
>ABZR87_RS14880 NADH-quinone oxidoreductase subunit A (Ralstonia sp. UNC404CL21Col) MNLEAYFPVLLFIVVGVGLGLALMTIGRVLGPNNPDPDKLSPYECGFEAFEDARMKFDVR YYLIAILFILFDLETAFLFPWGVALREIGWPGFFAMGVFLLEFLVGFVYIWKKGALDWE