Protein Info for ABZR87_RS14855 in Ralstonia sp. UNC404CL21Col

Annotation: NADH-quinone oxidoreductase subunit NuoF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01959: NADH oxidoreductase (quinone), F subunit
  • amino acids 20 to 420 (401 residues), 640.7 bits, E=3.5e-197
• PF01512: Complex1_51K
  • amino acids 53 to 224 (172 residues), 156.7 bits, E=6.8e-50
• PF10531: SLBB
  • amino acids 248 to 296 (49 residues), 44.7 bits, 1.5e-15
• PF10589: NADH_4Fe-4S
  • amino acids 337 to 419 (83 residues), 108.9 bits, E=1.4e-35

Best Hits

Swiss-Prot: 52% identical to NUOF2_RHIME: NADH-quinone oxidoreductase subunit F 2 (nuoF2) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00335, NADH dehydrogenase I subunit F [EC: 1.6.5.3] (inferred from 100% identity to rpi:Rpic_2209)

MetaCyc: 50% identical to NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial (Homo sapiens)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain F (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• NADH to cytochrome bo oxidase electron transfer I (2/2 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• aerobic respiration III (alternative oxidase pathway) (2/3 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• NAD(P)/NADPH interconversion (3/6 steps found)
• Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Protein Sequence (431 amino acids)

>ABZR87_RS14855 NADH-quinone oxidoreductase subunit NuoF (Ralstonia sp. UNC404CL21Col)
MTSLHDRHIQPLILAGLNGDNWHLEDYVKRGGYQQLKRILTEKITPEQVIADVKASGLRG
RGGAGFPTGLKWSFMPRQFPGQKYLVCNTDEGEPGTFKDRDIIRYNPHALIEGMAIGGYA
MGITVGYNYIHGEIWNEYKIFEQALEEARAAGFLGDNILGSGFNFQLHAHHGYGAYICGE
ETALLESLEGKKGQPRFKPPFPASFGLYGKPTTINNTETFAAVPFLLAIGPDNYLKMGKP
NNGGSKIFSVSGDVERPGNYEIPLGTPFSKLLELAGGMRGGKKLKAVIPGGSSAPVVPAD
LMMASDMDYDSIAKAGSMLGSGAVIVMDETRCMVKSLLRLSYFYYEESCGQCTPCREGTG
WLYRVVDRIEHGKGRQEDLDLLNNVAENIMGRTICALGDAAAMPVRGMLKHYWDEFAYHV
EHKQCMVPTYL