Protein Info for ABZR87_RS14465 in Ralstonia sp. UNC404CL21Col

Annotation: amidophosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 TIGR01134: amidophosphoribosyltransferase" amino acids 2 to 465 (464 residues), 517 bits, see alignment E=2.8e-159 PF13522: GATase_6" amino acids 65 to 200 (136 residues), 56.3 bits, see alignment E=5.2e-19 PF13537: GATase_7" amino acids 80 to 214 (135 residues), 47.8 bits, see alignment E=2.2e-16 PF00156: Pribosyltran" amino acids 280 to 394 (115 residues), 40.5 bits, see alignment E=2.7e-14

Best Hits

Swiss-Prot: 60% identical to PUR1_SHIFL: Amidophosphoribosyltransferase (purF) from Shigella flexneri

KEGG orthology group: K00764, amidophosphoribosyltransferase [EC: 2.4.2.14] (inferred from 99% identity to rpi:Rpic_2130)

MetaCyc: 60% identical to amidophosphoribosyltransferase (Escherichia coli K-12 substr. MG1655)
Amidophosphoribosyltransferase. [EC: 2.4.2.14]

Predicted SEED Role

"Amidophosphoribosyltransferase (EC 2.4.2.14)" in subsystem De Novo Purine Biosynthesis (EC 2.4.2.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (511 amino acids)

>ABZR87_RS14465 amidophosphoribosyltransferase (Ralstonia sp. UNC404CL21Col)
MCGIVGVVSATPVNQLIYDSLLLLQHRGQDAAGIATASGSTFHMHKANGMVRDVFRTRNM
RGLPGTSGIGQVRYPTAGSSSEEEAQPFYVNAPFGIVLAHNGNLTNSDQLREEMFRRDRR
HINTQSDSEVLLNVLADELQRASNDIPLNRDSIFTAVEGLHRRVRGSYAIAAEISGYGVL
AVRDPFGIRPLALGSQETPEGHIEYMVASESVALEGIGFKFERDVAPGEAIFIDLEGKLH
TKQCAANPVLSPCIFEYVYLARPDSRMDGVSVYDARLRMGDYLAEKIKREVTDRIDVVMP
IPDSSRPAAMQVANHLGVPYREGFFKNRYVGRTFIMPGQAVRKKSVRQKLNAMAIEFKDK
NVLIVDDSIVRGTTSSEIVQMARDAGAKKVIFASAAPPVKFPNVYGIDMPTRGELVAYGR
THEEIAKIIGADQLVYQDVEDMKRAVRDVNPALKDFDASCFDGKYVTGDIDEAYLDRLEA
ARNNSAKADRENAQNDDPRTQLHLQRSAVNE