Protein Info for ABZR87_RS14385 in Ralstonia sp. UNC404CL21Col

Annotation: dicarboxylate/amino acid:cation symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 47 to 70 (24 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 153 to 170 (18 residues), see Phobius details amino acids 198 to 224 (27 residues), see Phobius details amino acids 230 to 249 (20 residues), see Phobius details amino acids 309 to 344 (36 residues), see Phobius details amino acids 346 to 377 (32 residues), see Phobius details PF00375: SDF" amino acids 7 to 403 (397 residues), 374 bits, see alignment E=4.7e-116

Best Hits

Swiss-Prot: 39% identical to GLTP_ECOLI: Proton/glutamate-aspartate symporter (gltP) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to rpf:Rpic12D_1780)

MetaCyc: 39% identical to glutamate/aspartate : H+ symporter GltP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-122A; TRANS-RXN-162

Predicted SEED Role

"Proton/glutamate symport protein @ Sodium/glutamate symport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (422 amino acids)

>ABZR87_RS14385 dicarboxylate/amino acid:cation symporter (Ralstonia sp. UNC404CL21Col)
MNTKRLTSHIGLAMLLGIAVGWGCHEYAKDAAAAKDIASYFSIITDIFLRMIKMIIAPLV
FSTLVTGLASMSGGRSVGRVGLRAMIWFVCASATSLALGMLLVNFFQPGVHMNLALPDVS
ATSGLKTGDFTLKAFITHVFPRSIVEAMATNEILQILVFSLFFGAALSTMKNPMDTVIGR
GLEELTKLMFRITDYVMRFAPLGVFAAMAAAITVEGVGVLLTYGKLIGEFYLGLALLWAI
LFFVGYVLLGRSLGRLLGLIREPTMLAFATASSESAYPKTMEALEKFGVPKRVASFVLPL
GYSFNLDGSMMYQAFAVMFIAQAYNIQMSFTQQVTLLLVLMLTSKGMAGVARASLVVVAA
TLPMFHLPEAGLLLIIGIDQFFDMGRTATNVIGNSLATAVVAKYEPAEEESEAEVAAQPN
LG