Protein Info for ABZR87_RS14090 in Ralstonia sp. UNC404CL21Col

Annotation: phosphate ABC transporter permease PstA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 transmembrane" amino acids 29 to 51 (23 residues), see Phobius details amino acids 83 to 109 (27 residues), see Phobius details amino acids 124 to 145 (22 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details amino acids 202 to 223 (22 residues), see Phobius details amino acids 268 to 291 (24 residues), see Phobius details TIGR00974: phosphate ABC transporter, permease protein PstA" amino acids 30 to 292 (263 residues), 265.3 bits, see alignment E=2.5e-83 PF00528: BPD_transp_1" amino acids 102 to 290 (189 residues), 63.8 bits, see alignment E=8.7e-22

Best Hits

Swiss-Prot: 72% identical to PSTA_YERPE: Phosphate transport system permease protein PstA (pstA) from Yersinia pestis

KEGG orthology group: K02038, phosphate transport system permease protein (inferred from 98% identity to rpi:Rpic_2024)

MetaCyc: 72% identical to phosphate ABC transporter membrane subunit PstA (Escherichia coli K-12 substr. MG1655)
ABC-27-RXN [EC: 7.3.2.1]; 7.3.2.1 [EC: 7.3.2.1]

Predicted SEED Role

"Phosphate transport system permease protein PstA (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (294 amino acids)

>ABZR87_RS14090 phosphate ABC transporter permease PstA (Ralstonia sp. UNC404CL21Col)
MRTSSIPAVRADSEKIKARLQARRRNVNGIALALSLAAMAFGLVWLAWILWTTLSLGVGG
LSMSLFTEMTPPPNTPGGGLANAIAGSFLLVGMATLIGTPLGILAGIYLAEYGKTSMLAS
ATRFINDILLSAPSIVIGLFVYAVVVARVQHFSGIAGVLALALLQIPIVVRTTENMLNLV
PNAMREAAMALGTPKWKMILSITLKASYAGVITGVLLAVARIAGETAPLLFTALNNQFWS
LDLNQPVATLPTVIFKFAMSPFPEWQQLAWAGVFLITLGVLGLNVLARALFTKK