Protein Info for ABZR87_RS13235 in Ralstonia sp. UNC404CL21Col

Annotation: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 PF12804: NTP_transf_3" amino acids 12 to 143 (132 residues), 40.7 bits, see alignment E=2.8e-14 TIGR00453: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase" amino acids 12 to 240 (229 residues), 220 bits, see alignment E=1.3e-69 PF01128: IspD" amino acids 12 to 241 (230 residues), 217.9 bits, see alignment E=1.5e-68

Best Hits

Swiss-Prot: 83% identical to ISPD_RALSO: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (ispD) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K00991, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [EC: 2.7.7.60] (inferred from 95% identity to rpi:Rpic_1903)

Predicted SEED Role

"2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60)" in subsystem Isoprenoid Biosynthesis or Teichoic and lipoteichoic acids biosynthesis or polyprenyl synthesis (EC 2.7.7.60)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.60

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (252 amino acids)

>ABZR87_RS13235 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (Ralstonia sp. UNC404CL21Col)
MSISHPGRRRFALIPSAGTGSRAGGDLPKQYQAIAGRPMLWHTAQAFLASPEIDTVLVVT
TPGAQPLVQRFPDGGFDAPKLVEVDCGGDSRHASVTHGLAALRGLGAHDDDWVLVHDAAR
PGLTPGLIARLVSVVEAEGTQAAGGILALPVADTLKRADAAQHIDATVPRDGLWQAQTPQ
MFPLGLLERALREALLQHRIVTDEASAIEAAGHSPLLVPGALRNFKVTYPDDFALAEAIL
AQGAQPNEASQA