Protein Info for ABZR87_RS12845 in Ralstonia sp. UNC404CL21Col

Annotation: sigma-70 family RNA polymerase sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 15 to 171 (157 residues), 75.4 bits, see alignment E=2e-25 PF04542: Sigma70_r2" amino acids 19 to 85 (67 residues), 48.6 bits, see alignment E=1.2e-16 PF07638: Sigma70_ECF" amino acids 41 to 166 (126 residues), 24.3 bits, see alignment E=5.3e-09 PF08281: Sigma70_r4_2" amino acids 122 to 170 (49 residues), 46.6 bits, see alignment E=4.3e-16 PF04545: Sigma70_r4" amino acids 124 to 170 (47 residues), 32.9 bits, see alignment E=7.6e-12

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 52% identity to aaa:Acav_0814)

Predicted SEED Role

"FIG006045: Sigma factor, ECF subfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (176 amino acids)

>ABZR87_RS12845 sigma-70 family RNA polymerase sigma factor (Ralstonia sp. UNC404CL21Col)
MPAVQSEPRHEIDTAIDALYVQYSDWLLAWLGKKLACAEEAADVLHDTFMRVMAAPDRLG
ELREPRAYLTTTAKHLMIDRARRRRVECACLDELTLRSAQYGHAPSPEQRLAQMQSLQHT
SAMLETLSPSAREAVRLRYIEGQSHACIAEQLGKSTRMVRKYLVQAVERCATCAMR