Protein Info for ABZR87_RS12685 in Ralstonia sp. UNC404CL21Col

Annotation: sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 168 to 187 (20 residues), see Phobius details PF08521: 2CSK_N" amino acids 18 to 164 (147 residues), 132 bits, see alignment E=2.4e-42 PF00512: HisKA" amino acids 241 to 305 (65 residues), 49.8 bits, see alignment E=4.5e-17 PF02518: HATPase_c" amino acids 352 to 464 (113 residues), 94.2 bits, see alignment E=1e-30

Best Hits

KEGG orthology group: K07649, two-component system, OmpR family, sensor histidine kinase TctE [EC: 2.7.13.3] (inferred from 93% identity to rpf:Rpic12D_1517)

Predicted SEED Role

"Sensor protein PhoQ (EC 2.7.13.3)" in subsystem Lipid A modifications (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (472 amino acids)

>ABZR87_RS12685 sensor histidine kinase (Ralstonia sp. UNC404CL21Col)
MNPSSLRRQLSFWLLLPLLGLLALDAWLTYTRAMTAANAAFDRTLEASLKAMREGVRLRN
KQFAIDLPYLALDILESETGSSIFYRIVDAGGSTLTGYDDLPMPGGRRPTPYRTLFYDTQ
FRGMQVRMAAQPLPVRDAQSAETQVIWLLVGETLEPREALAHEILAGSLQQEVLLVVLAV
GIVWLGVRRGLRPLRQLSETVASRGTDELAPLPQQGLPAEVAPLVEAINQYVARLLRMVQ
ARKRFFADAAHQLKTPLAVIQAQSELALREPDGERIRRHLEPLHGTVRQAARGVQQLLSL
SRLETDSGYAPQLQPLRLDTLAGDVALELAPVARRSGVDLGFESEPVTVAGEPQWLQELV
GNLLDNAILYAGNGARVTLRVKRQAMAMLGEQAVLQVEDDGPGIAVPERDAVFGRFYRGA
ASEGHDGSGLGLAIVREIARLHGGTVALSETPGGGLTVSVYLALALMEEPTA