Protein Info for ABZR87_RS12295 in Ralstonia sp. UNC404CL21Col

Annotation: muconate/chloromuconate family cycloisomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02534: muconate and chloromuconate cycloisomerases
  • amino acids 2 to 369 (368 residues), 591.5 bits, E=3.2e-182
• PF02746: MR_MLE_N
  • amino acids 5 to 125 (121 residues), 120.3 bits, E=5.4e-39
• PF13378: MR_MLE_C
  • amino acids 148 to 361 (214 residues), 172.2 bits, E=1.4e-54

Best Hits

Swiss-Prot: 66% identical to CATB_ACIAD: Muconate cycloisomerase 1 (catB) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K01856, muconate cycloisomerase [EC: 5.5.1.1] (inferred from 97% identity to rpf:Rpic12D_1425)

MetaCyc: 62% identical to muconate cycloisomerase (Pseudomonas reinekei)
Muconate cycloisomerase. [EC: 5.5.1.1]

Predicted SEED Role

"Muconate cycloisomerase (EC 5.5.1.1)" in subsystem Catechol branch of beta-ketoadipate pathway or Muconate lactonizing enzyme family (EC 5.5.1.1)

MetaCyc Pathways

• aromatic compounds degradation via β-ketoadipate (9/9 steps found)
• superpathway of salicylate degradation (7/7 steps found)
• catechol degradation III (ortho-cleavage pathway) (6/6 steps found)
• catechol degradation to β-ketoadipate (4/4 steps found)
• mandelate degradation to acetyl-CoA (9/18 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (18/35 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Benzoate degradation via hydroxylation
• Fluorobenzoate degradation
• Toluene and xylene degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.5.1.1

Protein Sequence (369 amino acids)

>ABZR87_RS12295 muconate/chloromuconate family cycloisomerase (Ralstonia sp. UNC404CL21Col)
MIRSIEAILVDVPTIRPHKLSVATMHTQTLVLVQVRCEDGIEGWGEATTIGGLNYGEESP
ESIKVNIDTHIAPLLIGMEARNVAAAMARVRKTIQGNRFAKCALETALLDAQARRLGVPL
SELLGGRLRDALPVAWTLASGDTRKDIAEAEAMLAERRHRIFKLKIGLRPVADDVAHVLA
IKRALGDAVSVRVDVNQAWSELDAANGIAALQAGGVDLIEQPVRAENRAALERLARQFAV
PMMADEALHGPLDAFELACCASADVFAVKIAQSGGLVAAMQVAAIAQLAGIGLYGGTMLE
GAVGTAASAHVFSTFGELQFGTELFGPLLLTQELLTEPLQYRDFMLQVPTRPGLGIDIDQ
DKLARLRRQ