Protein Info for ABZR87_RS11675 in Ralstonia sp. UNC404CL21Col

Annotation: disulfide bond formation protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 39 to 57 (19 residues), see Phobius details amino acids 64 to 84 (21 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details PF02600: DsbB" amino acids 6 to 151 (146 residues), 128.9 bits, see alignment E=1e-41

Best Hits

Swiss-Prot: 89% identical to DSBB_RALSO: Disulfide bond formation protein B (dsbB) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03611, disulfide bond formation protein DsbB (inferred from 99% identity to rpi:Rpic_1246)

Predicted SEED Role

"Periplasmic thiol:disulfide oxidoreductase DsbB, required for DsbA reoxidation" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (159 amino acids)

>ABZR87_RS11675 disulfide bond formation protein B (Ralstonia sp. UNC404CL21Col)
MQANSRAFFLLIAVISFGVVGYALYLQHVEGLQPCPLCILQRFAFLGIGVFSLLAALSSA
TRLLWHGLGMLSGLAGLCVAGYHVSLLLNPKATCGIDPIENWVNALPTAKWLPQVFEADG
LCVGPMPPVLGLSVPVWSLIWLVILSLTLVVGMIRRERR