Protein Info for ABZR87_RS11225 in Ralstonia sp. UNC404CL21Col

Annotation: DHA2 family efflux MFS transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 518 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 57 to 77 (21 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 111 to 133 (23 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 172 to 194 (23 residues), see Phobius details amino acids 206 to 225 (20 residues), see Phobius details amino acids 237 to 256 (20 residues), see Phobius details amino acids 277 to 299 (23 residues), see Phobius details amino acids 311 to 329 (19 residues), see Phobius details amino acids 338 to 356 (19 residues), see Phobius details amino acids 369 to 395 (27 residues), see Phobius details amino acids 407 to 425 (19 residues), see Phobius details amino acids 484 to 501 (18 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 21 to 501 (481 residues), 536.6 bits, see alignment E=2.9e-165 PF07690: MFS_1" amino acids 24 to 417 (394 residues), 167.8 bits, see alignment E=3.4e-53 PF06609: TRI12" amino acids 26 to 296 (271 residues), 41 bits, see alignment E=9.6e-15

Best Hits

Swiss-Prot: 57% identical to EMRB_ECOLI: Multidrug export protein EmrB (emrB) from Escherichia coli (strain K12)

KEGG orthology group: K03446, MFS transporter, DHA2 family, multidrug resistance protein B (inferred from 95% identity to rpf:Rpic12D_1213)

MetaCyc: 57% identical to multidrug efflux pump membrane subunit EmrB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-363; TRANS-RXN-364; TRANS-RXN-365

Predicted SEED Role

"Inner membrane component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (518 amino acids)

>ABZR87_RS11225 DHA2 family efflux MFS transporter permease subunit (Ralstonia sp. UNC404CL21Col)
MATAAPKPLPPLTGAKLAIGTVALSLATFMNVLDSSIANVSIPAISGDLGVAPNQGTWVI
TSFAVANAISVPLTGWLTQRFGQVRLFVTSIILFVLASWACGLAPNMGTLITARIIQGAV
AGPMIPLSQSLLLSTYPPAKSSMALALWGMTTLVAPVMGPILGGWISDNMTWPWIFYINI
PVGILAAYATWVIYKDRESQTRSLPIDKVGLALLVIWVGSLQLMLDRGKELDWFNSTEII
VLTVVAVVGFAFFLIWELTEDHPVVDLTLFKGRNFSAGVVAISVAYGLFFGNLVILPLWL
QTIVGYTATDAGLIMAPVGIFAIILSPVIGKNLPKMDARWVATTAFLTFALVFWMRSHFT
TQIDTWTLLIPTLIQGAAMAMFFIPLTSIILSGLAPERIPAASGLSNFVRIMFGGIGASI
STTIWDNRSALHHAQLVEHANAYNPAYTSSINQYTQLGMPNLQANGAIERVISQQAAMLG
ANDIFWISAVLFIVLIVFIWLTKPAKSAGGAEAAAGAH