Protein Info for ABZR87_RS11210 in Ralstonia sp. UNC404CL21Col

Annotation: translation initiation factor IF-2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 964 PF04760: IF2_N" amino acids 1 to 52 (52 residues), 35.8 bits, see alignment 2.2e-12 amino acids 386 to 436 (51 residues), 55.8 bits, see alignment 1.3e-18 PF08364: IF2_assoc" amino acids 62 to 100 (39 residues), 48.7 bits, see alignment (E = 2.9e-16) TIGR00487: translation initiation factor IF-2" amino acids 381 to 964 (584 residues), 877.8 bits, see alignment E=4.3e-268 TIGR00231: small GTP-binding protein domain" amino acids 466 to 623 (158 residues), 107.5 bits, see alignment E=6e-35 PF01926: MMR_HSR1" amino acids 469 to 574 (106 residues), 40.2 bits, see alignment E=1.4e-13 PF00009: GTP_EFTU" amino acids 469 to 624 (156 residues), 130.5 bits, see alignment E=2.4e-41 PF00071: Ras" amino acids 470 to 625 (156 residues), 23.7 bits, see alignment E=1.3e-08 PF22042: EF-G_D2" amino acids 639 to 718 (80 residues), 104 bits, see alignment E=1.4e-33 PF11987: IF-2" amino acids 740 to 854 (115 residues), 153.5 bits, see alignment E=8.7e-49 PF03144: GTP_EFTU_D2" amino acids 885 to 952 (68 residues), 31.7 bits, see alignment 7e-11

Best Hits

Swiss-Prot: 81% identical to IF2_CUPNH: Translation initiation factor IF-2 (infB) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K02519, translation initiation factor IF-2 (inferred from 75% identity to bpm:BURPS1710b_1915)

Predicted SEED Role

"Translation initiation factor 2" in subsystem NusA-TFII Cluster or Translation initiation factors eukaryotic and archaeal or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (964 amino acids)

>ABZR87_RS11210 translation initiation factor IF-2 (Ralstonia sp. UNC404CL21Col)
MASTTVAQLAGELNRSASALLEQLQAAGVQKATPEDVITESDKTRLLDYLKRAHGSAEDG
ARKKITITKRETSEIRQADATGKTRTVQVEVKKKRVLVKRDEPNAAQAESEAAEAAPVVD
AEEIARREEEQRRQAELLARQEAELKARQEAMEREEAERRARQEAAEAEQKRQAELAAKK
AEEEAVAARAAAEASDEAPRRKAEEDAARLASEREAAQKAADEARVAADKIKAEEDAARK
RREAAEAEARAIREMMSAPARVLKTPAERKAEEVKKAEQSGTLHKPVKPAGEARPAAAAK
KPAAPAPAAAAPSSPSGDKKGGRGKSGWQDDNRTGKRGGLKTRGDTGGGADGWRSGSKGG
RNRHGDDNRNAFQAPTEPVVREVHVPETISVADLAHKMSVKAAEVIKQMMKLGQMVTINQ
VLDQETAMIVVEEMGHQAVAAKLDDPEALLIGGVEEPTNAEAETRPPVVTVMGHVDHGKT
SLLDYIRRAKVAAGEAGGITQHIGAYHVETDRGVITFLDTPGHEAFTAMRARGAKATDIV
ILVVAADDGVMPQTKEAIAHAKAAEVPIVVAITKVDKPEANPDRVKQELVAESVIPEEYG
GDVPFVPVSAKTGEGIDSLLENVLLQAEVLELKAPINAPAKGLVVEAQLDKGKGPIATVL
VQSGTLKRGDVVLAGTAYGRVRAMLDENGKPAKEAGPSIPVEIQGLSEVPGAGEEVLVLP
DERKAREIALFRQGKFRDVKLARQQAAKLENMLEQMSEGDVKSLPLIIKADVQGSQEALV
HSLQKLSTDEVRVQVVHAAVGGITESDVNLATASKAVIIGFNTRADAGARKLAEHQGIDI
RYYNIIYDAVDEVKAAMSGMLSPEKREETTGLVEVRQVFHVPKVGAVAGCMVLDGFVKRN
SLVRVLRANVVIFSGELDSLKRFKDDVKEVKQGFECGLSIKNFNDVQEGDQLEIYEITEV
ARTL