Protein Info for ABZR87_RS11115 in Ralstonia sp. UNC404CL21Col

Annotation: 2-oxoglutarate dehydrogenase complex dihydrolipoyllysine-residue succinyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 TIGR01347: dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex" amino acids 4 to 418 (415 residues), 552 bits, see alignment E=5e-170 PF00364: Biotin_lipoyl" amino acids 5 to 77 (73 residues), 73.9 bits, see alignment E=1.2e-24 PF02817: E3_binding" amino acids 118 to 151 (34 residues), 43 bits, see alignment 6.5e-15 PF00198: 2-oxoacid_dh" amino acids 189 to 417 (229 residues), 281.1 bits, see alignment E=9.9e-88

Best Hits

Swiss-Prot: 85% identical to ODO2_CUPNH: Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (sucB) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K00658, 2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC: 2.3.1.61] (inferred from 98% identity to rpi:Rpic_1098)

Predicted SEED Role

"Dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex (EC 2.3.1.61)" in subsystem TCA Cycle (EC 2.3.1.61)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.61

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (419 amino acids)

>ABZR87_RS11115 2-oxoglutarate dehydrogenase complex dihydrolipoyllysine-residue succinyltransferase (Ralstonia sp. UNC404CL21Col)
MAIVEVKVPQFSESVEEGTLISWKKKPGEAVAQDEILIEVETDKVVLEVPAPSAGVLAEV
LVADGATVTSEQLLAKIDTEGKAGAAAPAAAAPAPAAAAPAPAPAAAAPAAAAAGGVAMP
SAAKLMAENNLSAGQVAGTGRDGRITKGDVLGAVAGGAKPAAAAAPQAARPALQQVAAPV
DFAALGDRPEERVPMSRLRARIAERLVQSQSTNAILTTFNEVNMKPVMDLRAKFKDQFEK
THGVKLGFMSFFVKAAVHALKKYPVINASVDGNDIVYHGYFDIGIAVGSPRGLVVPILRN
ADQMSLADIEKKIAEFGQKAKDGKLTLDDLTGGTFSISNGGTFGSMLSTPIINPPQSAIL
GVHATKDRAVVENGQVVVRPMNYLAMSYDHRIIDGREAVLGLVAMKEALEDPARLLLDL