Protein Info for ABZR87_RS10840 in Ralstonia sp. UNC404CL21Col

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 35 to 54 (20 residues), see Phobius details amino acids 66 to 90 (25 residues), see Phobius details amino acids 112 to 144 (33 residues), see Phobius details amino acids 172 to 199 (28 residues), see Phobius details amino acids 224 to 244 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 81 to 251 (171 residues), 98.7 bits, see alignment E=1.8e-32

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 99% identity to rpf:Rpic12D_1136)

Predicted SEED Role

"ABC-type nitrate/sulfonate/bicarbonate transport system, permease component" in subsystem Alkanesulfonate assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (263 amino acids)

>ABZR87_RS10840 ABC transporter permease (Ralstonia sp. UNC404CL21Col)
MANRPLSPFALRTWQLGLLVVTLGVWHFATRSQEVAFFFGEPLIVAQRIWAWFVSEGDIY
QHLGVTLAETVLAFAIGTATGLGAGLWLALSPAASAVLDPYIKAANSMPRVILAPIFGVW
FGLGIWSKVALAVTLVFFIVFFNVYQGVKEVSPVVLANARMLGASQRQLLRFVYLPSATS
WVFSSLHTSVGLAFVGAVVGEYLGSARGVGYLILQAEGTFDINTVFAGIVVLTVFALVLD
WLVGLMEKRLMRWQPKSGETEKL