Protein Info for ABZR87_RS10765 in Ralstonia sp. UNC404CL21Col

Annotation: sigma-54 dependent transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 PF20161: VpsR" amino acids 8 to 119 (112 residues), 67.8 bits, see alignment E=1.9e-22 PF00158: Sigma54_activat" amino acids 149 to 314 (166 residues), 219.9 bits, see alignment E=4.3e-69 PF14532: Sigma54_activ_2" amino acids 149 to 319 (171 residues), 59 bits, see alignment E=1.7e-19 PF25601: AAA_lid_14" amino acids 320 to 392 (73 residues), 75.8 bits, see alignment E=4.9e-25 PF02954: HTH_8" amino acids 408 to 445 (38 residues), 25 bits, see alignment 3.2e-09

Best Hits

KEGG orthology group: None (inferred from 99% identity to rpf:Rpic12D_1122)

Predicted SEED Role

"Nitrogen regulation protein NR(I)" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (457 amino acids)

>ABZR87_RS10765 sigma-54 dependent transcriptional regulator (Ralstonia sp. UNC404CL21Col)
MREESLECTAACRTVVVASRAGMGEIDETILGADWHVRRVTSMRELGCAIRDGVPTAGLV
DFGSAFSAAELDLLERCMQVPHVGWVAALPPAMLNHERVRQLVRDYCVDYVQMPLRTDEA
AYSLRHAWGMASLAQEVTPAPKANHARMLGDCPAMHGLFRAIRKVAQNSAPAFIAGESGT
GKELTAQAIHEASSRAGGPFIAINCGAIPPHLIQSELFGYEKGAFTGAHQRHIGWVEHAN
GGTLFLDEIGDLPLESQVSLLRFLQQGTITRLGGHQAIPLDIRIISATHVDLEAAQHHGG
FRTDLFHRLCVLTLSVPPLRERGSDIVLLAEHILAQHASEASHRIRGFTPCALHAMMHYP
WPGNVRELINRVRRALVMTDNRKISAADLHLEGYASVSGQTLEEAREGAESDAIRTAIAR
NGFHMGMTARELAVSRVTLYRLMQKHGIRAEHPLHPA