Protein Info for ABZR87_RS10395 in Ralstonia sp. UNC404CL21Col

Annotation: single-stranded-DNA-specific exonuclease RecJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 564 transmembrane" amino acids 188 to 201 (14 residues), see Phobius details TIGR00644: single-stranded-DNA-specific exonuclease RecJ" amino acids 23 to 562 (540 residues), 485.5 bits, see alignment E=8.2e-150 PF01368: DHH" amino acids 74 to 230 (157 residues), 80.9 bits, see alignment E=1.5e-26 PF02272: DHHA1" amino acids 319 to 448 (130 residues), 90.8 bits, see alignment E=1.7e-29 PF17768: RecJ_OB" amino acids 465 to 562 (98 residues), 68.7 bits, see alignment E=6.2e-23

Best Hits

KEGG orthology group: K07462, single-stranded-DNA-specific exonuclease [EC: 3.1.-.-] (inferred from 98% identity to rpf:Rpic12D_1054)

Predicted SEED Role

"Single-stranded-DNA-specific exonuclease RecJ (EC 3.1.-.-)" in subsystem DNA-replication or DNA Repair Base Excision or DNA repair, bacterial RecFOR pathway (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (564 amino acids)

>ABZR87_RS10395 single-stranded-DNA-specific exonuclease RecJ (Ralstonia sp. UNC404CL21Col)
MTRIAVRSHSPDAATTLAGHGIHPVLARILAARGVARPDELSTELTDLLPPTQLKGIDDA
ARYLADAIAANKRMLIIADYDCDGATACAVGVRGLRMLGAQVSYIVPNRFEYGYGLSPEI
VALAAREKPDVLVTVDNGIADVAGVAAANALSIDVVVTDHHMPGAQLPAARVIVNPNQPG
CGFPSKNLAGVGVMFYVLLALRAELRKRGVFTPQDQPRLDALLDLVALGTVADVVKLDAN
NRLLVAQGLKRMRAGRMCPGIAALFRVAGREARRASTFDLGFGLGPRLNAAGRLADMSLG
IECLLTDDYDRAMSIAAELDGMNRERREIEAGMQQEALAILDSMNAFDGAGRHTIAVYNE
TWHQGVIGIVASRIKDKFHRPVFTFAPGDDGVIKGSGRSIPGFHLRDALDAVHKRSPGLI
VKFGGHAMAAGLTLREDGFETFVATFEAVGREWLTEALLSRVLETDGEADPECFTPQFVE
LLETQVWGQGFPAPSFCGEFDVLSQAVLKEKHLKLKLGRGKQHFDAIWFNHAEPLGASAY
VAYRLDNNTFNGITRVQMVIEHAQ