Protein Info for ABZR87_RS10180 in Ralstonia sp. UNC404CL21Col

Annotation: DegQ family serine endoprotease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 503 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details TIGR02037: peptidase Do" amino acids 45 to 491 (447 residues), 529.4 bits, see alignment E=3.7e-163 PF00089: Trypsin" amino acids 115 to 269 (155 residues), 57.5 bits, see alignment E=5.5e-19 PF13365: Trypsin_2" amino acids 117 to 248 (132 residues), 128.8 bits, see alignment E=8.6e-41 PF00595: PDZ" amino acids 283 to 357 (75 residues), 37.1 bits, see alignment E=9.9e-13 amino acids 405 to 469 (65 residues), 23.9 bits, see alignment E=1.3e-08 PF13180: PDZ_2" amino acids 288 to 378 (91 residues), 62 bits, see alignment E=1.6e-20 amino acids 418 to 491 (74 residues), 33.3 bits, see alignment E=1.5e-11 PF17820: PDZ_6" amino acids 314 to 367 (54 residues), 38.8 bits, see alignment 1.8e-13 amino acids 430 to 475 (46 residues), 29.3 bits, see alignment 1.7e-10

Best Hits

Swiss-Prot: 48% identical to DEGPL_PSEF1: Probable periplasmic serine endoprotease DegP-like (Psefu_3239) from Pseudomonas fulva (strain 12-X)

KEGG orthology group: K01362, [EC: 3.4.21.-] (inferred from 98% identity to rpf:Rpic12D_0988)

Predicted SEED Role

"HtrA protease/chaperone protein"

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (503 amino acids)

>ABZR87_RS10180 DegQ family serine endoprotease (Ralstonia sp. UNC404CL21Col)
MRTARSVHALRLLCVAAAVAAGSALVPAHAQNATGSVATGTYGLPDFADLVEKVSPAVVN
IRTTEKVRMQQGGPSDDDMAEFFRRFFGVPMPGMPGQGQKRRNAPPQQEEEQSRGVGSGF
IISGDGYILTNAHVVEGAETIYVTLIDKREYRAKLIGLDKRTDVALVKVEATALPSLKLG
DSDKVRVGEWVLAIGSPFGLDNTVTAGIVSAKGRDTGDYLPFIQSDVAVNPGNSGGPLIN
LRGEVIGINNQIYSQSGGYMGISFSIPIDEAMRVAEQLKATGRVTRGRIGVAIDNVPKDA
AESLGLGRARGAYVGNVESGGPADKAGIEAGDIVLKYNGRDIEKAGDLQRQVGETKPGTR
ATVQVWRKGATRDLTVTVAELQADTKVAQRSKGAQPDNSQQGPGKPNALGLVVSDLSDGA
RREFKTKSGVEVQVSEGPAARVGIRPGDLILRVGDTDVTNAKQFNEVVAKLDKNRMVAVF
VRRGDATQVVTLRPSAARSGSGQ