Protein Info for ABZR87_RS10165 in Ralstonia sp. UNC404CL21Col
Annotation: RNA polymerase sigma factor RpoE
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 62% identical to RPOE_ECO57: ECF RNA polymerase sigma-E factor (rpoE) from Escherichia coli O157:H7
KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 100% identity to rpf:Rpic12D_0985)MetaCyc: 62% identical to RNA polymerase sigma factor RpoE (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"RNA polymerase sigma factor RpoE" in subsystem Transcription initiation, bacterial sigma factors
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (199 amino acids)
>ABZR87_RS10165 RNA polymerase sigma factor RpoE (Ralstonia sp. UNC404CL21Col) MSEREADQILVERVQQGDKRAFELLVVKYHRKIIRLVSRLIRDPAEVEDVAQDAFIKAYR ALPQFRGESAFYTWLYRIAVNTAKNYLATQGRRPESSSDIDTEEAETFADGELLRDINTP DSMLHTKQVAETVNRAMEALPEELRTAITLREIEGLSYEEIAEAMECPIGTVRSRIFRAR EAIAEKLRPLLGTVEGKRW