Protein Info for ABZR87_RS10165 in Ralstonia sp. UNC404CL21Col

Annotation: RNA polymerase sigma factor RpoE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 TIGR02939: RNA polymerase sigma factor RpoE" amino acids 1 to 191 (191 residues), 323 bits, see alignment E=7.4e-101 PF07638: Sigma70_ECF" amino acids 10 to 187 (178 residues), 39.9 bits, see alignment E=8.5e-14 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 21 to 187 (167 residues), 114.3 bits, see alignment E=4.4e-37 PF04542: Sigma70_r2" amino acids 25 to 93 (69 residues), 70.3 bits, see alignment E=1.8e-23 PF08281: Sigma70_r4_2" amino acids 133 to 182 (50 residues), 68.3 bits, see alignment E=7.3e-23 PF04545: Sigma70_r4" amino acids 136 to 183 (48 residues), 42 bits, see alignment E=1.1e-14

Best Hits

Swiss-Prot: 62% identical to RPOE_ECO57: ECF RNA polymerase sigma-E factor (rpoE) from Escherichia coli O157:H7

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 100% identity to rpf:Rpic12D_0985)

MetaCyc: 62% identical to RNA polymerase sigma factor RpoE (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RNA polymerase sigma factor RpoE" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (199 amino acids)

>ABZR87_RS10165 RNA polymerase sigma factor RpoE (Ralstonia sp. UNC404CL21Col)
MSEREADQILVERVQQGDKRAFELLVVKYHRKIIRLVSRLIRDPAEVEDVAQDAFIKAYR
ALPQFRGESAFYTWLYRIAVNTAKNYLATQGRRPESSSDIDTEEAETFADGELLRDINTP
DSMLHTKQVAETVNRAMEALPEELRTAITLREIEGLSYEEIAEAMECPIGTVRSRIFRAR
EAIAEKLRPLLGTVEGKRW