Protein Info for ABZR87_RS10050 in Ralstonia sp. UNC404CL21Col

Annotation: sodium:proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 28 to 48 (21 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 124 to 146 (23 residues), see Phobius details amino acids 160 to 181 (22 residues), see Phobius details amino acids 202 to 224 (23 residues), see Phobius details amino acids 254 to 279 (26 residues), see Phobius details amino acids 288 to 308 (21 residues), see Phobius details amino acids 324 to 345 (22 residues), see Phobius details amino acids 367 to 389 (23 residues), see Phobius details amino acids 403 to 424 (22 residues), see Phobius details amino acids 445 to 468 (24 residues), see Phobius details PF16980: CitMHS_2" amino acids 24 to 468 (445 residues), 649.5 bits, see alignment E=2.5e-199

Best Hits

KEGG orthology group: None (inferred from 96% identity to rpf:Rpic12D_0963)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (469 amino acids)

>ABZR87_RS10050 sodium:proton antiporter (Ralstonia sp. UNC404CL21Col)
MKRLWPLVFLFVCGLARAADVNGAELSLLWGVPFAGILLSIAIAPLLVPKLWHDHYGKIA
AAWALALLVPFGIAFGTEAAIASVNHAALAEYIPFIALIAALYVVAGGICIRGNLHGTPK
LNTGLIALGTALASIMGTTGAAMLLIRPLLRANEARRHRAHVVVFFIFLVANAGGALTPL
GDPPLFLGFLQGVDFFWTTQHLWRQTLTMWVLLLAIFFVIDSYFHRTGKEELPNITDATP
DDAGPLRFEGNVNFVLLAGILGLVLMSGLWKPGIVFYVMGTEVLLQNVVRDIGLVTIALL
SLWLTPASARAGNEFNWEPILEVAKLFAGIFITIGPVIAMLKAGVDGPFAGIVHLVNDSA
GQPNNAMYFWATGLLSSFLDNAPTYLVFFNTAGGDASMLMSEGASTLAAISAAAVFMGAN
TYIGNAPNLMVKAIAESRGLQMPSFFGYMLWSVCILLPIFVLMTFVFFR