Protein Info for ABZR87_RS09955 in Ralstonia sp. UNC404CL21Col

Annotation: LacI family DNA-binding transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF00356: LacI" amino acids 3 to 48 (46 residues), 62.7 bits, see alignment 4.5e-21 PF00532: Peripla_BP_1" amino acids 60 to 313 (254 residues), 131.5 bits, see alignment E=8.7e-42 PF13407: Peripla_BP_4" amino acids 62 to 307 (246 residues), 89.1 bits, see alignment E=7.1e-29 PF13377: Peripla_BP_3" amino acids 169 to 336 (168 residues), 128.9 bits, see alignment E=4.3e-41

Best Hits

Swiss-Prot: 47% identical to PURR_PHOPR: HTH-type transcriptional repressor PurR (purR) from Photobacterium profundum (strain SS9)

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 99% identity to rpi:Rpic_0879)

Predicted SEED Role

"Ribose operon repressor" in subsystem D-ribose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (346 amino acids)

>ABZR87_RS09955 LacI family DNA-binding transcriptional regulator (Ralstonia sp. UNC404CL21Col)
MATIKDVAALAGVSFTTVSHVINNTRPVNAETRKRVEEAIRATRYVPSAVARSLKHRTTR
TIGVLVPTATNPYFAELARGIEDVCAAAGYSVILCNSDDDPRKQRDYLRVLMEKRVDGII
VSSAGPDTALVEALGESALPIVMVDRPTEGIQADQVQVDHEEGAYMATKHLLELGHRRIA
CISGPSALSVTAERLAGFHRALREAGVPEASARIAEGDFTSPGGYRAARQLLTEGEMPTA
IFAGNDLMGIGALRAAAELGIPVPKALSVMGFDDIELSRYVYPALSTVGQSIRQLGETTA
QTLLEHLGDNALRHPVEEHRARRIVLPPRLSLRESTAEPERPARAA