Protein Info for ABZR87_RS09940 in Ralstonia sp. UNC404CL21Col

Annotation: excinuclease ABC subunit UvrB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 696 TIGR00631: excinuclease ABC subunit B" amino acids 24 to 680 (657 residues), 1084 bits, see alignment E=0 PF04851: ResIII" amino acids 35 to 138 (104 residues), 41.4 bits, see alignment E=5.3e-14 PF00270: DEAD" amino acids 38 to 104 (67 residues), 24.4 bits, see alignment E=7.6e-09 PF17757: UvrB_inter" amino acids 178 to 268 (91 residues), 115.5 bits, see alignment E=3.4e-37 PF27431: UvrB_3rd" amino acids 273 to 334 (62 residues), 106.4 bits, see alignment 2e-34 PF00271: Helicase_C" amino acids 454 to 564 (111 residues), 78 bits, see alignment E=2.3e-25 PF12344: UvrB" amino acids 571 to 613 (43 residues), 80.2 bits, see alignment 2.7e-26 PF02151: UVR" amino acids 648 to 682 (35 residues), 36.5 bits, see alignment (E = 1e-12)

Best Hits

Swiss-Prot: 95% identical to UVRB_RALSO: UvrABC system protein B (uvrB) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03702, excinuclease ABC subunit B (inferred from 88% identity to bvi:Bcep1808_2295)

MetaCyc: 70% identical to UvrABC excision nuclease subunit B (Escherichia coli K-12 substr. MG1655)
3.1.25.-

Predicted SEED Role

"Excinuclease ABC subunit B" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (696 amino acids)

>ABZR87_RS09940 excinuclease ABC subunit UvrB (Ralstonia sp. UNC404CL21Col)
MTDLSQVPSPHDESKFVTFEGSPFQLYQPYPPAGDQPEAIRQLVENIEDGLSYQTLLGVT
GSGKTFTMANVIAQVGRPAIVFAPNKTLAAQLYSEFREFFPRNAVEYFVSYYDYYQPEAY
VPQRDLFIEKDSSINEHIEQMRLSATKSLLERRDVVIVATVSAIYGIGNPSEYHQMILTL
RAGDKVSQRDVIARLIAMQYTRNETDFQRGTFRVRGDTVDIFPAEHAEMAVRLELFDDEV
ESLQLFDPLTGRVRQKIPRFTVYPSSHYVTPRETVLRAIETIKAELRERLDFFYKENKLV
EAQRLEQRTRFDLEMLQELGFCKGIENYSRHLSGSAPGEPPPTLVDYLPPDALMFLDESH
VLIGQLNGMYNGDRARKETLAEYGFRLPSALDNRPLKFAEFETKMRQVTFVSATPGDYEK
KTAGTEVVEQVVRPTGLVDPIIEVRPATTQVDDLLSEIHVRVEAGERVLVTTLTKRMAEQ
LTEFLSENGIKVRYLHSDIDTVERVEIIRDLRLGTFDVLVGINLLREGLDIPEVSLVAIL
DADKEGFLRAERSLIQTIGRAARNVNGTAILYADRMTDSMKKAIDETERRRAKQIAHNEA
HGITPRGVVKRIKDIIDGVYNVDDARAELKAAQEAAKYEDMSEKQASKEIKRLEKQMLDH
AKNLEFEKAAAVRDQLAKLKSQLFGASGEDHIVPAA