Protein Info for ABZR87_RS09900 in Ralstonia sp. UNC404CL21Col

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 47 to 67 (21 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 107 to 128 (22 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 161 to 180 (20 residues), see Phobius details amino acids 191 to 213 (23 residues), see Phobius details amino acids 223 to 244 (22 residues), see Phobius details amino acids 254 to 273 (20 residues), see Phobius details amino acids 278 to 296 (19 residues), see Phobius details PF00892: EamA" amino acids 18 to 151 (134 residues), 57.4 bits, see alignment E=9.9e-20 amino acids 162 to 296 (135 residues), 78.4 bits, see alignment E=3.3e-26

Best Hits

KEGG orthology group: None (inferred from 97% identity to rpf:Rpic12D_0933)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (311 amino acids)

>ABZR87_RS09900 DMT family transporter (Ralstonia sp. UNC404CL21Col)
MRQAADSPLAARAADKLLGVLLIAVSAASFGAMAIFTHYAYASGANVVGLLIVRFVIAAA
ALMVVMRVRRIGIPPWSRVAGLAAMGGIGYAGQSFAFFTALNYAPASLVALLLYLYPMFV
TVLAAIFLRERLTTTAIIALVLCSVGAGLTVGGAGLSGGSLLGIGLGVASAVIYSIYITV
GARVTRGLDPLACTTVICTAAAVVYTGMALLGAPAHLPGTFSGWAAALAIAGLSTVVAIL
TFFAGLQKLGAAQASMLSTLEPVVTVLLAALLLGESIAPMQMTGGALILAGVLWLTRADA
KPAGHGADDMA