Protein Info for ABZR87_RS09825 in Ralstonia sp. UNC404CL21Col

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 48 to 71 (24 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details amino acids 137 to 159 (23 residues), see Phobius details amino acids 167 to 184 (18 residues), see Phobius details amino acids 196 to 217 (22 residues), see Phobius details amino acids 235 to 254 (20 residues), see Phobius details amino acids 265 to 283 (19 residues), see Phobius details amino acids 289 to 306 (18 residues), see Phobius details PF00892: EamA" amino acids 18 to 146 (129 residues), 46.1 bits, see alignment E=3.1e-16 amino acids 165 to 301 (137 residues), 58.2 bits, see alignment E=5.7e-20

Best Hits

KEGG orthology group: None (inferred from 94% identity to rpi:Rpic_0848)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (312 amino acids)

>ABZR87_RS09825 DMT family transporter (Ralstonia sp. UNC404CL21Col)
MNKSVTLPTPHIDHAERRGLLLGFIGVAIFSQTLPFTRMAVAELDATFVALARAVLASVL
ALVLLGATGAFSAGKRPRGNQCWQLAVTAMGVVVGFPLFSSLAMRDVPAAHGAIITGLLP
LATAIFAAWFGRERPSAGFWLCAVIGSVLVVSFALLQGAGALHRADWLLFAAMVTGALGY
ATGGRLARELGGMQTIAWALVVSLPVLLPLVGALAWLPSTHQAEALAHASSRAWMGLAYV
SAFSMFIGFLFWYSGLAAGGVARVGQIQLLQPFMTLIGGWLLLGESLDAPTVLFALAVIA
VVGIGRRTSVRR