Protein Info for ABZR87_RS09490 in Ralstonia sp. UNC404CL21Col

Annotation: lipopolysaccharide assembly protein LapB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 24 to 24 (1 residues), see Phobius details PF13432: TPR_16" amino acids 45 to 90 (46 residues), 22 bits, see alignment 6.4e-08 PF14559: TPR_19" amino acids 190 to 236 (47 residues), 25.1 bits, see alignment 6.5e-09 PF18073: Zn_ribbon_LapB" amino acids 383 to 407 (25 residues), 34.7 bits, see alignment (E = 3.8e-12)

Best Hits

KEGG orthology group: None (inferred from 98% identity to rpi:Rpic_0782)

Predicted SEED Role

"Heat shock (predicted periplasmic) protein YciM, precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (424 amino acids)

>ABZR87_RS09490 lipopolysaccharide assembly protein LapB (Ralstonia sp. UNC404CL21Col)
MDFDLWWLLAIPLVFGLGWVAARLDARQLRTEQSSLPRSYFKGLNFLLNEQPDKAIDAFI
EVARLDPETTELHFALGSLFRRRGETERAIRVHQNLVNRPDLPPHERDHALFELGQDFLR
AGLLDRAEESLRMLMEGTFAEPAKRVLLELYEVEKEWRKAIDAARELQKLQGKDYAVQIA
QFCCEVAQEALQRKDVPTAVEWLERALQENPKNVRATIQLGDVAQGQGDIEGAIKRWRSI
EQQNTAFLPLVAERLMKAYTQLGRAAEGLAWLRSKMDARLGPELLDTVYKYELDVHGIDD
AVALMRDQIRRQPSLMALTRLVEAEATRASEAVGHEAPATVDVAESALADPVEAGSNADI
QRAQDLGAIRDLLQSRTRNLARYTCQECGFRARLFYWQCPGCNRWETYAPRRTETLGGSG
GASM