Protein Info for ABZR87_RS09255 in Ralstonia sp. UNC404CL21Col

Annotation: glutamine--tRNA ligase/YqeY domain fusion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 583 TIGR00440: glutamine--tRNA ligase" amino acids 48 to 583 (536 residues), 748.1 bits, see alignment E=3.1e-229 PF00749: tRNA-synt_1c" amino acids 48 to 363 (316 residues), 356.3 bits, see alignment E=1.8e-110 PF03950: tRNA-synt_1c_C" amino acids 369 to 468 (100 residues), 94.4 bits, see alignment E=6.1e-31 PF20974: tRNA-synt_1c_C2" amino acids 488 to 560 (73 residues), 87.2 bits, see alignment E=1.4e-28

Best Hits

Swiss-Prot: 97% identical to SYQ_RALPJ: Glutamine--tRNA ligase (glnS) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K01886, glutaminyl-tRNA synthetase [EC: 6.1.1.18] (inferred from 97% identity to rpi:Rpic_0737)

Predicted SEED Role

"Glutaminyl-tRNA synthetase (EC 6.1.1.18)" in subsystem tRNA aminoacylation, Glu and Gln (EC 6.1.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (583 amino acids)

>ABZR87_RS09255 glutamine--tRNA ligase/YqeY domain fusion protein (Ralstonia sp. UNC404CL21Col)
MSQDNANANGSTAAAPTSNFLRQIIDGDLTQGTYANRKDATGQPIPPVVTRFPPEPNGYL
HIGHAKSIWVNFGMARDYNGRCHLRFDDTNPVKEDTEYVDSIIDAVHWLGYSWSDAGGEH
LYYASDYFEQLYGFAEVLIQRGVAYVDSQSAEQIAANRGDFTKPGTPSPFRDRSVDENLA
LFRDMRAGKYKDGEHVLRAKIDMAAPNIVMRDPVLYRIRHAHHHRTGDAWCIYPMYDFTH
CISDALENITHSLCTLEFENNRPLYDWVLDHLRDAGVLSAPLPHQYEFARLHLTYAITSK
RKLLQLVTEKRVDGWDDPRMPTLVGIRRRGYTPESIQLFCERVGVSKADSWIDMSILEGA
VRDDLDARAPRSVAVLDPVKLVLDNVPADFNEPCSAPVHPKQPELGRREFPLTRELWIER
EDFTETPPKGYFRLFPGNKVRLRYGYVIECTGCDKDAAGNITAVHANIIPDTKSGTPGAD
SVKVKGNIHWVSAAHALEAEVRLYDRLFSDPQPDSGDKNFLDALNPHSKKIVTAYLEPTL
TTAKPEDRFQFERHGYFVADRIDSQPGKPVFNRVVGLKDSWGK