Protein Info for ABZR87_RS09120 in Ralstonia sp. UNC404CL21Col

Annotation: arylformamidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 TIGR03035: arylformamidase" amino acids 5 to 208 (204 residues), 339.4 bits, see alignment E=4.5e-106 PF04199: Cyclase" amino acids 7 to 151 (145 residues), 65.2 bits, see alignment E=4e-22

Best Hits

Swiss-Prot: 94% identical to KYNB_RALPJ: Kynurenine formamidase (kynB) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K07130, (no description) (inferred from 96% identity to rpf:Rpic12D_0776)

Predicted SEED Role

"Kynurenine formamidase, bacterial (EC 3.5.1.9)" in subsystem Aromatic amino acid degradation or NAD and NADP cofactor biosynthesis global (EC 3.5.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (209 amino acids)

>ABZR87_RS09120 arylformamidase (Ralstonia sp. UNC404CL21Col)
MERTLWDISPALSPATPTWPGDTPFSHEIAWKLEGDCPVNVGRITLSPHTGAHADAPLHY
RADGAAIGQVPLGAYLGPCRVIHCMGVVRVEPEHVRDALTDVPPRVLLRTYAQMPQTAWD
DDFAAVAPETIALLAAHGVKLIGVDTASLDPQTSKTMDAHHAVGKHGLAILEGLVLDDVP
AGDYELIALPLKFATLDASPVRAVLRSLP