Protein Info for ABZR87_RS09005 in Ralstonia sp. UNC404CL21Col

Annotation: YeeE/YedE family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 53 to 74 (22 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details amino acids 121 to 143 (23 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 205 to 223 (19 residues), see Phobius details amino acids 273 to 294 (22 residues), see Phobius details amino acids 314 to 335 (22 residues), see Phobius details amino acids 341 to 360 (20 residues), see Phobius details PF04143: Sulf_transp" amino acids 30 to 358 (329 residues), 200 bits, see alignment E=3.5e-63

Best Hits

KEGG orthology group: K07112, (no description) (inferred from 98% identity to rpi:Rpic_0688)

Predicted SEED Role

"Lipocalin-related protein and Bos/Can/Equ allergen" in subsystem Sulfur oxidation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (371 amino acids)

>ABZR87_RS09005 YeeE/YedE family protein (Ralstonia sp. UNC404CL21Col)
MPEIDLNALSHTVLWGTFALTFVFGAILQRTHFCTMGAVSDVVNIGDWNRLRMWALAIGV
AMIGTGCLSWLGLIDTSKTIYTASKLLWLSSLVGGLLFGFGMVLGSGCGSKTLVRIGGGN
LKSVVVFVFLGLAAYMTLKGVFGVVRVATVDSVAIALPTSQDLPSVLGHAFPADARVLRL
ALALMIGGALSLWALLGRDFRTGDNLLGGIGVGLIIVGMWYVSGHLGYVQEDPNTLQEAF
VATNSGRMEALSFVAPVSYTLEWLMFFSDTSKVLTVGIVSVLGVIAGSAAVALVTRTFRW
EGFANAEDTGNHIIGGILMGIGGVTALGCTIGQGLSGVSTLAIGSFIALAGIVIGAVLAF
RYQMWRMERLV