Protein Info for ABZR87_RS08845 in Ralstonia sp. UNC404CL21Col

Annotation: NAD-dependent succinate-semialdehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 503 PF00171: Aldedh" amino acids 34 to 497 (464 residues), 572.1 bits, see alignment E=3.8e-176 TIGR01780: succinate-semialdehyde dehydrogenase" amino acids 45 to 496 (452 residues), 719.6 bits, see alignment E=7.6e-221

Best Hits

Swiss-Prot: 63% identical to DAVD_PSEPK: Glutarate-semialdehyde dehydrogenase (davD) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K00135, succinate-semialdehyde dehydrogenase (NADP+) [EC: 1.2.1.16] (inferred from 99% identity to rpf:Rpic12D_0700)

MetaCyc: 65% identical to NAD(P)-dependent succinate-semialdehyde dehydrogenase (Pseudomonas fluorescens)
Succinate-semialdehyde dehydrogenase (NAD(P)(+)). [EC: 1.2.1.16]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.16

Use Curated BLAST to search for 1.2.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (503 amino acids)

>ABZR87_RS08845 NAD-dependent succinate-semialdehyde dehydrogenase (Ralstonia sp. UNC404CL21Col)
MAEALDASRTAANALERITDRTLVKTQSYVDGAWVGAADGATFPVYDPATNAHLTDVANL
GHAETLRAIDAANAAWPAWRELTGKERAGLMRRWFDLLIANADDLAALMTAEQGKPLAEA
KGEIVYGASFIEWFAEEAKRVSGDVMASTWRDKRMVVLKQPVGVCASITPWNFPLAMITR
KVAPAMAAGCTIVIKPAEQTPLSALAMAELAHRAGIPKGVVNVVTGDADRSIAIGKALCE
SPIVRHLSFTGSTPVGRILMQQCSPTVKKVALELGGHAPFIVFDDADIDAAVEGAVQSKY
RNAGQTCVCTNRFYVHASVYDTFVEKLSAKVRGIKVGNGFESGVVQGPLIDDQAVEKVQR
HIDDATQKGARLTAGGKLMQGFGSQRFVEPTVLADATPDMLIAREETFGPVSAIFKFQDE
AEVVRLANDTEFGLASYFFSRDIGRIWRVAEQLEYGMVGINTGLISNEVAPFGGIKQSGL
GREGSVYGIDEYLELKYLCMGGI