Protein Info for ABZR87_RS08745 in Ralstonia sp. UNC404CL21Col

Annotation: phosphomannomutase/phosphoglucomutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02878: PGM_PMM_I
  • amino acids 8 to 143 (136 residues), 125.3 bits, E=2.8e-40
• PF02879: PGM_PMM_II
  • amino acids 157 to 254 (98 residues), 96.7 bits, E=2.2e-31
• PF02880: PGM_PMM_III
  • amino acids 259 to 364 (106 residues), 77.3 bits, E=2.1e-25
• PF00408: PGM_PMM_IV
  • amino acids 373 to 449 (77 residues), 47.3 bits, E=3.5e-16

Best Hits

Swiss-Prot: 58% identical to PGM_NEIMB: Phosphoglucomutase (pgm) from Neisseria meningitidis serogroup B (strain MC58)

KEGG orthology group: K01835, phosphoglucomutase [EC: 5.4.2.2] K01840, phosphomannomutase [EC: 5.4.2.8] (inferred from 98% identity to rpi:Rpic_0641)

MetaCyc: 55% identical to phosphomannomutase (Pseudomonas aeruginosa)
Phosphomannomutase. [EC: 5.4.2.8]; Phosphoglucomutase. [EC: 5.4.2.8, 5.4.2.2]

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of anaerobic sucrose degradation (16/19 steps found)
• O-antigen building blocks biosynthesis (E. coli) (10/11 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• UDP-α-D-glucose biosynthesis (2/2 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• sucrose degradation II (sucrose synthase) (4/5 steps found)
• GDP-mannose biosynthesis (3/4 steps found)
• glycogen biosynthesis I (from ADP-D-Glucose) (3/4 steps found)
• sucrose degradation IV (sucrose phosphorylase) (3/4 steps found)
• β-1,4-D-mannosyl-N-acetyl-D-glucosamine degradation (2/3 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• chitin biosynthesis (6/9 steps found)
• CDP-6-deoxy-D-gulose biosynthesis (3/5 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• glucose and glucose-1-phosphate degradation (3/5 steps found)
• sucrose biosynthesis II (5/8 steps found)
• starch degradation V (2/4 steps found)
• colanic acid building blocks biosynthesis (7/11 steps found)
• glycogen degradation II (3/6 steps found)
• glucosylglycerol biosynthesis (2/5 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (4/8 steps found)
• glycogen degradation I (4/8 steps found)
• starch degradation III (1/4 steps found)
• starch biosynthesis (5/10 steps found)
• β-(1,4)-mannan degradation (2/7 steps found)
• superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (5/14 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (6/19 steps found)
• streptomycin biosynthesis (2/18 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Pentose phosphate pathway
• Starch and sucrose metabolism
• Streptomycin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.2.2 or 5.4.2.8

Protein Sequence (462 amino acids)

>ABZR87_RS08745 phosphomannomutase/phosphoglucomutase (Ralstonia sp. UNC404CL21Col)
MSTINPTIFKAYDIRGIVGKTVDAETARLIGRAFGSAARAKGESAVVIGRDGRLSGPELL
AALADGLRASGVDVIDLGLVATPMVYFGTNIELAGRRATSGVMVTGSHNPPDYNGFKMVL
AGQAIYGEQIQALRTRIEQADFTEGAGDYVQVDIRQQYIDRIVSDVKVSRPMKIAVDCGN
GVAGAFAPELFRAMGCEVTELFCEVDGHFPNHHPDPAHVENLQDLVRTLQTTDCELGLAF
DGDGDRLGVVTKDGQVIFPDRQLMLFAQEVLSRNPGGEIIFDVKCTGKLAPFIREHGGKA
TMWKTGHSLVKAKLKETGAPLAGEMSGHIFFKDRWYGFDDGLYTGARLLEIVSRLADPSA
TLNALPNSHCTPELQLKCAEGESFELLDKIKANATFAGAKEVNRIDGVRVEYEDGFGLAR
PSNTTPVVVMRFEADNDAAMARIQGEFRRVILAEKPDAQLPF