Protein Info for ABZR87_RS08745 in Ralstonia sp. UNC404CL21Col
Annotation: phosphomannomutase/phosphoglucomutase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 58% identical to PGM_NEIMB: Phosphoglucomutase (pgm) from Neisseria meningitidis serogroup B (strain MC58)
KEGG orthology group: K01835, phosphoglucomutase [EC: 5.4.2.2] K01840, phosphomannomutase [EC: 5.4.2.8] (inferred from 98% identity to rpi:Rpic_0641)MetaCyc: 55% identical to phosphomannomutase (Pseudomonas aeruginosa)
Phosphomannomutase. [EC: 5.4.2.8]; Phosphoglucomutase. [EC: 5.4.2.8, 5.4.2.2]
Predicted SEED Role
No annotation
MetaCyc Pathways
- superpathway of anaerobic sucrose degradation (16/19 steps found)
- O-antigen building blocks biosynthesis (E. coli) (10/11 steps found)
- dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
- UDP-α-D-glucose biosynthesis (2/2 steps found)
- sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
- sucrose degradation II (sucrose synthase) (4/5 steps found)
- GDP-mannose biosynthesis (3/4 steps found)
- glycogen biosynthesis I (from ADP-D-Glucose) (3/4 steps found)
- sucrose degradation IV (sucrose phosphorylase) (3/4 steps found)
- β-1,4-D-mannosyl-N-acetyl-D-glucosamine degradation (2/3 steps found)
- GDP-α-D-glucose biosynthesis (2/3 steps found)
- trehalose degradation V (2/3 steps found)
- superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
- chitin biosynthesis (6/9 steps found)
- CDP-6-deoxy-D-gulose biosynthesis (3/5 steps found)
- D-galactose degradation I (Leloir pathway) (3/5 steps found)
- glucose and glucose-1-phosphate degradation (3/5 steps found)
- sucrose biosynthesis II (5/8 steps found)
- starch degradation V (2/4 steps found)
- colanic acid building blocks biosynthesis (7/11 steps found)
- glycogen degradation II (3/6 steps found)
- glucosylglycerol biosynthesis (2/5 steps found)
- glycogen biosynthesis III (from α-maltose 1-phosphate) (4/8 steps found)
- glycogen degradation I (4/8 steps found)
- starch degradation III (1/4 steps found)
- starch biosynthesis (5/10 steps found)
- β-(1,4)-mannan degradation (2/7 steps found)
- superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (5/14 steps found)
- superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (6/19 steps found)
- streptomycin biosynthesis (2/18 steps found)
- superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
KEGG Metabolic Maps
- Fructose and mannose metabolism
- Galactose metabolism
- Glycolysis / Gluconeogenesis
- Nucleotide sugars metabolism
- Pentose phosphate pathway
- Starch and sucrose metabolism
- Streptomycin biosynthesis
Isozymes
No predicted isozymesUse Curated BLAST to search for 5.4.2.2 or 5.4.2.8
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (462 amino acids)
>ABZR87_RS08745 phosphomannomutase/phosphoglucomutase (Ralstonia sp. UNC404CL21Col) MSTINPTIFKAYDIRGIVGKTVDAETARLIGRAFGSAARAKGESAVVIGRDGRLSGPELL AALADGLRASGVDVIDLGLVATPMVYFGTNIELAGRRATSGVMVTGSHNPPDYNGFKMVL AGQAIYGEQIQALRTRIEQADFTEGAGDYVQVDIRQQYIDRIVSDVKVSRPMKIAVDCGN GVAGAFAPELFRAMGCEVTELFCEVDGHFPNHHPDPAHVENLQDLVRTLQTTDCELGLAF DGDGDRLGVVTKDGQVIFPDRQLMLFAQEVLSRNPGGEIIFDVKCTGKLAPFIREHGGKA TMWKTGHSLVKAKLKETGAPLAGEMSGHIFFKDRWYGFDDGLYTGARLLEIVSRLADPSA TLNALPNSHCTPELQLKCAEGESFELLDKIKANATFAGAKEVNRIDGVRVEYEDGFGLAR PSNTTPVVVMRFEADNDAAMARIQGEFRRVILAEKPDAQLPF