Protein Info for ABZR87_RS07705 in Ralstonia sp. UNC404CL21Col

Annotation: 4-hydroxythreonine-4-phosphate dehydrogenase PdxA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 TIGR00557: 4-hydroxythreonine-4-phosphate dehydrogenase PdxA" amino acids 4 to 332 (329 residues), 399.3 bits, see alignment E=7.4e-124 PF04166: PdxA" amino acids 41 to 328 (288 residues), 343.2 bits, see alignment E=6.8e-107

Best Hits

Swiss-Prot: 89% identical to PDXA_RALSO: 4-hydroxythreonine-4-phosphate dehydrogenase (pdxA) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K00097, 4-hydroxythreonine-4-phosphate dehydrogenase [EC: 1.1.1.262] (inferred from 96% identity to rpf:Rpic12D_0408)

Predicted SEED Role

"4-hydroxythreonine-4-phosphate dehydrogenase (EC 1.1.1.262)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.1.1.262)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.262

Use Curated BLAST to search for 1.1.1.262

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>ABZR87_RS07705 4-hydroxythreonine-4-phosphate dehydrogenase PdxA (Ralstonia sp. UNC404CL21Col)
MLNIAITTGEPAGIGPDITVAALLHLARQASPRYADVQWHVMGDAALLQARADAIGQGDF
WRVVSTALTVVARPLGAPVRAGVLDAANGRYVLDLLDAAIDGCLIGTADGIRYDAMVTAP
VQKSTINDAGVPFTGHTEYLAERSHTPRVVMMLAGPQPAHDNAMLRVALATTHLPLREVP
DAITPTVLDETLDIVQRDLRARFGLKAPRILVTGLNPHAGESGHLGREEIEVIEPAIARA
RTRGIDARGPYPADTLFQPRLLADADCVLAMYHDQGLAPLKYGTFGHGVNITLGLPFVRT
SVDHGTALDLAGTGRAEFGSMIEAIDTAIAMARHTARS