Protein Info for ABZR87_RS07695 in Ralstonia sp. UNC404CL21Col

Annotation: LPS-assembly protein LptD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 809 signal peptide" amino acids 1 to 49 (49 residues), see Phobius details PF19838: LptD_2" amino acids 243 to 351 (109 residues), 24 bits, see alignment E=2.3e-09 PF04453: LptD" amino acids 339 to 715 (377 residues), 336.5 bits, see alignment E=4e-104

Best Hits

Swiss-Prot: 86% identical to LPTD_RALSO: LPS-assembly protein LptD (lptD) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K04744, LPS-assembly protein (inferred from 97% identity to rpi:Rpic_0391)

Predicted SEED Role

"Outer membrane protein Imp, required for envelope biogenesis / Organic solvent tolerance protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (809 amino acids)

>ABZR87_RS07695 LPS-assembly protein LptD (Ralstonia sp. UNC404CL21Col)
MTEPNRARKNRQRAAVAAPDQRPANRRGTLALRPLVFAVAGVWTATSAAQSAGTVQATAP
AVTPASSVTALATSGPTTPGGSPLVPKMAEPVQRPDNTVPTFTAADKMDGRTNEDIHLRG
NGELRRNGSVLKGDTLDYNQDTDVATATGNVRLFKGGTLVTGPDAKLKVTANEGTISTPT
YEFHSTGGHGTAERIDFIDKDNSRITRGTYTTCSPDNVDWYFSASRIDIDSDRQVGTGRN
GVLHFFGVPVFAAPVMDFPLNDDRRSGFLAPVFGYNSRSGADVTLPYYFNIAPNRDLTLY
PRLLSQRGLQLGAEYRYLDASYSGVLRGEFLPDDREAGRNRWSISAVHTQRLAPGLTGYI
NYNKVSDNTYPDDLGRSIVTATQRQYVQEGGVTYSIGDWVALARVQKFQTLSTATTPLAA
PYERLPQLSLTYNRYDVGGFDINFLTDYTRFSIPTANTVQGERLFMQPTISYPIVRPGWY
VTPKFILNTTAYRLDRPAGDTQDTQINRTLPTFSLDSGMTFERDAPLVSKLFGVSYIQTL
EPRVFYVYTPYRDQSQIPLFDTGQSDYNLGQIFTENPYTGYDRIADNNKVTAGVTTRLIE
AESGVERLRATIAQRIDLDGQRVTLAGAAPTSVRRYSDLLGATTIQMFRGIFFDTNLQYN
QDIDRIMRSTVAFSWKPEANKVINLGYRYYRQDANTGQLPLEQADISTQWPITRRLYGLG
RIGYDLDARKPSDMLLGLEYVADCWVGRLAVQRYSNAVSGYTTHIFAQIEFKGLSKVGNN
PIDVIRLNVPGYQPVTAQPITPSVLDQYE