Protein Info for ABZR87_RS07620 in Ralstonia sp. UNC404CL21Col

Annotation: Holliday junction branch migration DNA helicase RuvB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 PF05496: RuvB_N" amino acids 34 to 192 (159 residues), 275.1 bits, see alignment E=4.8e-86 TIGR00635: Holliday junction DNA helicase RuvB" amino acids 38 to 340 (303 residues), 491 bits, see alignment E=5.6e-152 PF00004: AAA" amino acids 69 to 191 (123 residues), 76.6 bits, see alignment E=7.9e-25 PF17864: AAA_lid_4" amino acids 195 to 268 (74 residues), 111.1 bits, see alignment E=5e-36 PF05491: WHD_RuvB" amino acids 270 to 339 (70 residues), 84.8 bits, see alignment E=1e-27

Best Hits

Swiss-Prot: 99% identical to RUVB_RALPJ: Holliday junction ATP-dependent DNA helicase RuvB (ruvB) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K03551, holliday junction DNA helicase RuvB (inferred from 99% identity to rpi:Rpic_0376)

MetaCyc: 71% identical to Holliday junction branch migration complex subunit RuvB (Escherichia coli K-12 substr. MG1655)
3.1.22.4-RXN [EC: 3.1.21.10]

Predicted SEED Role

"Holliday junction DNA helicase RuvB" in subsystem DNA-replication or RuvABC plus a hypothetical

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.21.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (358 amino acids)

>ABZR87_RS07620 Holliday junction branch migration DNA helicase RuvB (Ralstonia sp. UNC404CL21Col)
MIETDKLAAKAVSAERIISASPASPNEEAFERALRPKLLDEYVGQEKVRGQLDIFMTAAK
NRSEALDHVLLFGPPGLGKTTLAHIIAREMGVNLRQTSGPVLERPGDLAALLTNLEANDV
LFIDEIHRLSPVVEEILYPALEDYQIDIMIGEGPAARSVKLDLQPFTLVGATTRAGMLTN
PLRDRFGIVARLEFYTPAELAKIVTRSSGLLNAHIVDEGALEIAKRSRGTPRIANRLLRR
VRDYAEVKADGVITREVADAALAMLDVDAVGFDLMDRKLLEAILHKFNGGPVGIDNLAAA
IGEERDTIEDVLEPYLIQQGYLQRTPRGRVATASAYQHFGLGAPKSGPVPDLWDDNNN