Protein Info for ABZR87_RS07525 in Ralstonia sp. UNC404CL21Col

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 transmembrane" amino acids 31 to 52 (22 residues), see Phobius details amino acids 64 to 85 (22 residues), see Phobius details amino acids 105 to 122 (18 residues), see Phobius details amino acids 142 to 164 (23 residues), see Phobius details amino acids 207 to 227 (21 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 23 to 128 (106 residues), 67.1 bits, see alignment E=7.9e-23 PF00528: BPD_transp_1" amino acids 43 to 234 (192 residues), 93.2 bits, see alignment E=8.4e-31

Best Hits

Swiss-Prot: 58% identical to GLTJ_ECOL6: Glutamate/aspartate import permease protein GltJ (gltJ) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K10003, glutamate/aspartate transport system permease protein (inferred from 98% identity to rpi:Rpic_0358)

MetaCyc: 58% identical to glutamate/aspartate ABC transporter membrane subunit GltJ (Escherichia coli K-12 substr. MG1655)
ABC-13-RXN [EC: 7.4.2.1]; 7.4.2.1 [EC: 7.4.2.1]

Predicted SEED Role

"Glutamate Aspartate transport system permease protein GltJ (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (242 amino acids)

>ABZR87_RS07525 amino acid ABC transporter permease (Ralstonia sp. UNC404CL21Col)
MNYHWNWGVFFTEAAQNQTYLDWLLAGLKTTVVLGLSSWIIALVIGSVLGVLRTVPNKWL
SGLAAAYVELFRNIPLIVQLFIWYFVVPELVPGGDYIKQMNPNTSMFLCAMLCLGTFTAA
RVCEQVRSGINSLPRGQRNAGLAMGFTLAQTYRYVMLPMSFRIIVPPLTSEFLNIFKNSA
VASTIGLLELAAQGRQLVDYTAQPYESFIAVTLMYMLINLTVMGLMRWVEARSRLPGFIG
GK