Protein Info for ABZR87_RS07425 in Ralstonia sp. UNC404CL21Col

Annotation: sodium:solute symporter family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 37 to 57 (21 residues), see Phobius details amino acids 72 to 94 (23 residues), see Phobius details amino acids 115 to 140 (26 residues), see Phobius details amino acids 152 to 171 (20 residues), see Phobius details amino acids 174 to 175 (2 residues), see Phobius details amino acids 178 to 196 (19 residues), see Phobius details amino acids 220 to 240 (21 residues), see Phobius details amino acids 260 to 282 (23 residues), see Phobius details amino acids 314 to 339 (26 residues), see Phobius details amino acids 360 to 380 (21 residues), see Phobius details amino acids 392 to 411 (20 residues), see Phobius details amino acids 418 to 440 (23 residues), see Phobius details amino acids 446 to 466 (21 residues), see Phobius details PF00474: SSF" amino acids 30 to 426 (397 residues), 127.9 bits, see alignment E=2.4e-41

Best Hits

KEGG orthology group: None (inferred from 99% identity to rpf:Rpic12D_0353)

Predicted SEED Role

"sodium-solute symporter, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (479 amino acids)

>ABZR87_RS07425 sodium:solute symporter family protein (Ralstonia sp. UNC404CL21Col)
MLIWFVIVYWVISVGIGLWAALRVRNTADFAVAGRSLPFYVVTATVFATWFGSEAVLGIP
AEFLKDGLHGVVADPFGSSLCLVLVGLFFAKPLYRMNLLTIGDFYRNRFGRVAETLTTLC
IVVSYLGWVAAQIKALGLVFYTVSDGAVSQDLGMMIGAGSVLVYTLFGGMWSVAVTDFIQ
MIIIVIGMLYIGWEVSGQAGGVGTVVAHAAASGKFSFWPAFNPIEIIGFVTAWITMMLGS
IPQQDVFQRVTSSRTERIAGTASVLGGVLYFMFAFVPMFLAYSATLIDPQMVAKYIDTDS
QMILPNLVLQHAPIFAQVMFFGALLSAIKSCASATLLAPSVTFAENVLRPLLPNMDDKRF
LRVMQAVVLTFTVLVTLFALNSHLSIFHMVESAYKVTLVAAFVPLAFGLFWKRATKQGGL
LAIIFGLAAWIWCEVFLSGAMLPPQLVGLLASFGAMVLGSLGPQWIENRAPTTKAATQA