Protein Info for ABZR87_RS07235 in Ralstonia sp. UNC404CL21Col

Annotation: MMPL family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 806 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 254 to 271 (18 residues), see Phobius details amino acids 278 to 299 (22 residues), see Phobius details amino acids 306 to 326 (21 residues), see Phobius details amino acids 347 to 370 (24 residues), see Phobius details amino acids 376 to 395 (20 residues), see Phobius details amino acids 425 to 443 (19 residues), see Phobius details amino acids 665 to 683 (19 residues), see Phobius details amino acids 690 to 710 (21 residues), see Phobius details amino acids 716 to 736 (21 residues), see Phobius details amino acids 748 to 769 (22 residues), see Phobius details amino acids 776 to 795 (20 residues), see Phobius details PF03176: MMPL" amino acids 161 to 414 (254 residues), 70.2 bits, see alignment E=8.2e-24

Best Hits

KEGG orthology group: None (inferred from 94% identity to rpf:Rpic12D_0317)

Predicted SEED Role

"FIG021862: membrane protein, exporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (806 amino acids)

>ABZR87_RS07235 MMPL family transporter (Ralstonia sp. UNC404CL21Col)
MKRLHALRRPAVLVWLTGLLLCAVVIGRTRFTADLSAFLPRSPSAEQRVLVDQLREGLVS
RLILVGIEGGDAATRATLSKQLAATLRADARFSAVNNGEPVSEARDRQFVFDHRYVLSPA
VTPQRFSTEGLHAALGESLDLLSSSAGLVAKTMLPRDPTGEVAALVGQLDNTALPSSMHG
VWASRDGQRAVLVVQTTAAGSDTDAQAQAIDTVRRAFEAAARTVPNATSTRIVMTGPGVF
SVDSRDTIKHDVERLSAVSLVLVVALLLTVYRSPRTVALGLLPVLSGVAAGVAAVSLTFG
AVHGLTLGFGTTLIGEAVDYSIYLFVQSARLRGATANDSLRAWIATYWPTIRLGVLTSVC
GFASMLFSGFPGLVQLGLYSIVGLVTAALVTRYVLPHLRGAEGATRDVSRVGAWLARATS
AAPRLRWLLAAVLIGACTTLALHRDGLWSRELAALSPVPAKSQALDASLRADVGAPDVRY
LVVIPAATEQAALEGAEKIAAQLQPLVDNGVLAGFENPARYLPSDATQQARLASLPPADA
LAARMRSAVEDQPIRVKPDLFAPFIADVEAARTQPLLRRADLKGTSMALAVDALLTERAG
QWSAMLPLRAPAAAPATANNATNRPSLDAAPIRSAVAQANVPGALFVDMKAEADRLYVDY
VREDLRLSLAGFAAIALLLLVALRSPQRTLRALAPLVAAVLVVTAGFAVARVPLTILHLV
GMLLIVAVGSNYALFFNQRTQAIAPQTLVSLLVANLATVAGFGLLAFSRVPMLETFGLTV
GPGAMLALVFAAILAPRAHHDQHAAA