Protein Info for ABZR87_RS07125 in Ralstonia sp. UNC404CL21Col

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 45 to 64 (20 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 102 to 121 (20 residues), see Phobius details amino acids 133 to 157 (25 residues), see Phobius details amino acids 163 to 183 (21 residues), see Phobius details amino acids 205 to 229 (25 residues), see Phobius details amino acids 242 to 262 (21 residues), see Phobius details amino acids 269 to 286 (18 residues), see Phobius details amino acids 292 to 310 (19 residues), see Phobius details amino acids 332 to 354 (23 residues), see Phobius details amino acids 360 to 379 (20 residues), see Phobius details PF07690: MFS_1" amino acids 13 to 345 (333 residues), 151 bits, see alignment E=4.3e-48 PF00083: Sugar_tr" amino acids 49 to 187 (139 residues), 30 bits, see alignment E=2.7e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpf:Rpic12D_0303)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (387 amino acids)

>ABZR87_RS07125 MFS transporter (Ralstonia sp. UNC404CL21Col)
MNGLELRAAASLAGIFALRMLGLFMIMPVFAVFAKTLPDGNNTQLVAFAIGVYGLTQAVL
YIPYGWLSDRFGRKPVIVTGLVIFAVGSLVAAFSHSVAGIAVGRAIQGAGAISSAVIAFV
ADLTREEHRTKAMAMIGGSIGLSFAVAIVSAPVIFRWVGMPGMFTAIGVLAIVAIGVVLW
VVPNPPRPPEHVKAPFREVLRNPELLRLNFGVFALHATQTALFVVLPHMLEAAGLPVDSH
WKIYLPVMGVSFVLMVPAIIAAEKRGKMKVVLLSAVALVMVAQLALGEVNPTLAALAIAL
LVYFLGFNVLEASQPSLVSKYAPGVRKGAAMGVYNTTQALGLFAGGAGGGWILLHAGQHA
VFLTCAALAFAWLIIASPMQMPALRRH