Protein Info for ABZR87_RS07115 in Ralstonia sp. UNC404CL21Col

Annotation: Na/Pi cotransporter family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 558 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 41 to 59 (19 residues), see Phobius details amino acids 67 to 89 (23 residues), see Phobius details amino acids 95 to 121 (27 residues), see Phobius details amino acids 132 to 154 (23 residues), see Phobius details amino acids 175 to 199 (25 residues), see Phobius details amino acids 208 to 227 (20 residues), see Phobius details amino acids 245 to 264 (20 residues), see Phobius details amino acids 274 to 294 (21 residues), see Phobius details TIGR00704: Na/Pi-cotransporter II-related protein" amino acids 1 to 305 (305 residues), 254.6 bits, see alignment E=8.3e-80 PF02690: Na_Pi_cotrans" amino acids 13 to 148 (136 residues), 122.2 bits, see alignment E=1.6e-39 amino acids 157 to 227 (71 residues), 31.3 bits, see alignment E=1.9e-11 PF01895: PhoU" amino acids 340 to 424 (85 residues), 44.8 bits, see alignment E=1.3e-15 amino acids 446 to 520 (75 residues), 24.3 bits, see alignment E=3.4e-09

Best Hits

KEGG orthology group: K03324, phosphate:Na+ symporter (inferred from 91% identity to rsl:RPSI07_2987)

Predicted SEED Role

"Sodium-dependent phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (558 amino acids)

>ABZR87_RS07115 Na/Pi cotransporter family protein (Ralstonia sp. UNC404CL21Col)
MITLLKLLSGVALLVWGTQTVKVGMLRLYGADLRRLLSRSVSNRFSALLAGIGVTCLVQS
SNATATIVGAFVAQGLMGVSSALAILLGANVGTAIMAQVFALDLSWLSPLLIFFGVILHL
SRKGSAVGHFGRVLIGLGLIMMALELISIASSPMVEANALRVLLGSISSDTGLNMLIGAV
LTLLCYSSLAVVLFCATLAASAAVSVKVAFAIVLGANIGSAVAALATTPSSSQAARRATL
GNLLSRMLGAALALPFLDTLAAWAPHAGVAPQHVVVAFHVVFNVALAVLLIGFTEAMARL
CARILPGGAHIDDLVAPRYLDPSALATPTLALGNAAREVLRIGDRVEHMLDNTLRVLKTN
DVRLLQTTRAIDDEVDALYTAIKLYLTQLSHEALDAREGKRWADIISLTINLEHAGDILD
RMLQDVREKKIAHKLAFSEAGMEELEDMHGRLVTNLKLALSVFLTGDLRSAQKLMLEKAH
FRDLEKRYSRSHLTRISAQTAESIETSSLHLDIISDFKRLNSLFCAAAYPVLDEAGALNR
SRMKDADEVGTEAAPAGH