Protein Info for ABZR87_RS07110 in Ralstonia sp. UNC404CL21Col

Annotation: LysE family translocator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 39 to 63 (25 residues), see Phobius details amino acids 72 to 89 (18 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details amino acids 148 to 174 (27 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details PF01810: LysE" amino acids 13 to 204 (192 residues), 132.4 bits, see alignment E=7.6e-43

Best Hits

KEGG orthology group: None (inferred from 98% identity to rpf:Rpic12D_0300)

Predicted SEED Role

"L-lysine permease" in subsystem Lysine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (206 amino acids)

>ABZR87_RS07110 LysE family translocator (Ralstonia sp. UNC404CL21Col)
MPHVVLFLLTSIAITVMPGPDNLQVIARGASQGRKAGLSAAAGFASGCLFHTTLAALGLA
AVLQSSPVAFQAIRWLGAAYLIWLGVQALRSKGGVGLNPAGPQAAPDLWRVYRQSVFANL
LNPKVTLFFVVFLPQFVDAQAGHAALQMLLLGGVFMAQTIVVFSIYGWCAAALGGWMRRT
PRASLWLDRVSGCIFIGLGLRVALTK