Protein Info for ABZR87_RS07025 in Ralstonia sp. UNC404CL21Col

Annotation: A/G-specific adenine glycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 TIGR01084: A/G-specific adenine glycosylase" amino acids 25 to 291 (267 residues), 331.9 bits, see alignment E=1.8e-103 PF00730: HhH-GPD" amino acids 55 to 187 (133 residues), 82.3 bits, see alignment E=4.7e-27 PF00633: HHH" amino acids 119 to 147 (29 residues), 27.6 bits, see alignment (E = 2.7e-10) PF14815: NUDIX_4" amino acids 259 to 374 (116 residues), 79.6 bits, see alignment E=2.4e-26

Best Hits

KEGG orthology group: K03575, A/G-specific adenine glycosylase [EC: 3.2.2.-] (inferred from 95% identity to rpi:Rpic_0256)

Predicted SEED Role

"A/G-specific adenine glycosylase (EC 3.2.2.-)" in subsystem DNA repair, bacterial (EC 3.2.2.-)

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-

Use Curated BLAST to search for 3.2.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (382 amino acids)

>ABZR87_RS07025 A/G-specific adenine glycosylase (Ralstonia sp. UNC404CL21Col)
MTASPRRTRRVAQPVPVLPPLPDDFATRVIAWQQRHGRHHLPWQNTGDAYRTWLSEIMLQ
QTQVSAVLGYYARFIERFPTVQALAAAPADDVMAAWAGLGYYTRARNLHRCAQIVVAEHG
GIFPRDPDVLATLPGIGRSTAAAIAAFSYGVRAAILDGNVKRVFARVFGIDGFPGDKRVE
GTMWRIAEAVLPPAEGIQPYTQGLMDLGATVCTRGKPACLTGERPCPLESLCEARSSGRV
MELPVPRPRKAIPERAATLVIALHADAVLLQRRPQRGIWGGLWSLPLVGEMDDALDAHPL
DVGTVRGAAQAYGDVSTVEMAGALTHTFTHFRLHMHLLRAEIATPAALDDNWRWVPLAKL
NSVGLPAPVKLALETLVQPSLI