Protein Info for ABZR87_RS07015 in Ralstonia sp. UNC404CL21Col

Annotation: bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 TIGR00577: DNA-formamidopyrimidine glycosylase" amino acids 1 to 290 (290 residues), 251.7 bits, see alignment E=4.3e-79 PF01149: Fapy_DNA_glyco" amino acids 1 to 132 (132 residues), 106.2 bits, see alignment E=2.5e-34 PF06831: H2TH" amino acids 151 to 241 (91 residues), 74.9 bits, see alignment E=6.1e-25 PF06827: zf-FPG_IleRS" amino acids 263 to 290 (28 residues), 42.8 bits, see alignment (E = 5.2e-15)

Best Hits

Swiss-Prot: 94% identical to FPG_RALPJ: Formamidopyrimidine-DNA glycosylase (mutM) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K10563, formamidopyrimidine-DNA glycosylase [EC: 3.2.2.23 4.2.99.18] (inferred from 94% identity to rpf:Rpic12D_0281)

Predicted SEED Role

"Formamidopyrimidine-DNA glycosylase (EC 3.2.2.23)" in subsystem DNA Repair Base Excision (EC 3.2.2.23)

Isozymes

Compare fitness of predicted isozymes for: 4.2.99.18

Use Curated BLAST to search for 3.2.2.23 or 4.2.99.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (291 amino acids)

>ABZR87_RS07015 bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase (Ralstonia sp. UNC404CL21Col)
MPELPEVEVTRLGLLPHVTERRIVRVVVRHHGLRWPIDPALPELLAGLTVTRLLRRGKYL
LIECVPAVGQSGHPADTAGGWLLIHLGMTGTLRVLETPVPPGPHDHVDIELADATGVPIT
LRYRDPRRFGAVLWHAGDEAGLAEHPLLRNLGIEPFDAPFDGDWMFARTRGRRVAIKSAL
LAGDIVVGVGNIYCSESLFRAGIRPTTAAGRISRPRYAALAEAIRATLADAIARGGSTLR
DFVGSDGQSGYFQLDAFVYDRAGLPCRVCGTPIRQIVQGQRSTFYCPTCQR