Protein Info for ABZR87_RS06990 in Ralstonia sp. UNC404CL21Col

Annotation: ribose-phosphate pyrophosphokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 PF13793: Pribosyltran_N" amino acids 6 to 123 (118 residues), 177.3 bits, see alignment E=1.3e-56 TIGR01251: ribose-phosphate diphosphokinase" amino acids 7 to 314 (308 residues), 407.2 bits, see alignment E=1.7e-126 PF00156: Pribosyltran" amino acids 155 to 262 (108 residues), 76.8 bits, see alignment E=1.8e-25 PF14572: Pribosyl_synth" amino acids 205 to 314 (110 residues), 99.4 bits, see alignment E=3.7e-32

Best Hits

Swiss-Prot: 98% identical to KPRS_RALSO: Ribose-phosphate pyrophosphokinase (prs) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K00948, ribose-phosphate pyrophosphokinase [EC: 2.7.6.1] (inferred from 100% identity to rpi:Rpic_0250)

MetaCyc: 65% identical to ribose-phosphate diphosphokinase (Escherichia coli K-12 substr. MG1655)
Ribose-phosphate diphosphokinase. [EC: 2.7.6.1]

Predicted SEED Role

"Ribose-phosphate pyrophosphokinase (EC 2.7.6.1)" in subsystem De Novo Purine Biosynthesis or Pentose phosphate pathway (EC 2.7.6.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.6.1

Use Curated BLAST to search for 2.7.6.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>ABZR87_RS06990 ribose-phosphate pyrophosphokinase (Ralstonia sp. UNC404CL21Col)
MSSEGLMVFTGNANPKLAEAVVKHLGIPLGKALVGRFSDGEVQVEIQENVRGKHVFILQS
TCAPTNDNLMELMVMVDALKRASARRITAAIPYFGYARQDRRPRSARVAITAKVVANMLE
VAGVERVLTMDLHADQIQGFFDIPVDNIYASPILLEDLRKKNYEDLLVVSPDVGGVVRAR
ALAKQLGVDLAIIDKRRPKANVAEVMNIIGEVDGRNCVIMDDMIDTGGTLCKAAQVLKER
GAKQVFSYCTHPVLSGGAAARIADSALDEVVVTDTIPLREDAIKCGKIRQLSTAPLLAET
FTRIVRGDSIMSLFAE