Protein Info for ABZR87_RS06770 in Ralstonia sp. UNC404CL21Col

Annotation: NAD(P)H-dependent glycerol-3-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01210: NAD_Gly3P_dh_N
  • amino acids 3 to 164 (162 residues), 124.4 bits, E=6.5e-40
• PF07479: NAD_Gly3P_dh_C
  • amino acids 184 to 325 (142 residues), 182.1 bits, E=9.8e-58
• PF20618: GPD_NAD_C_bact
  • amino acids 245 to 309 (65 residues), 76.1 bits, E=3.9e-25

Best Hits

Swiss-Prot: 86% identical to GPDA_RALSO: Glycerol-3-phosphate dehydrogenase [NAD(P)+] (gpsA) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K00057, glycerol-3-phosphate dehydrogenase (NAD(P)+) [EC: 1.1.1.94] (inferred from 97% identity to rpi:Rpic_0213)

Predicted SEED Role

"Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.94)

MetaCyc Pathways

• phosphatidylglycerol biosynthesis I (6/6 steps found)
• phosphatidylglycerol biosynthesis II (6/6 steps found)
• superpathway of phospholipid biosynthesis III (E. coli) (10/12 steps found)
• CDP-diacylglycerol biosynthesis I (4/4 steps found)
• CDP-diacylglycerol biosynthesis II (4/4 steps found)
• glycerol-3-phosphate shuttle (2/2 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (9/13 steps found)
• CDP-diacylglycerol biosynthesis III (3/5 steps found)
• phosphatidate biosynthesis (yeast) (3/5 steps found)
• glucosylglycerol biosynthesis (2/5 steps found)
• 1,3-propanediol biosynthesis (engineered) (4/9 steps found)
• superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.94

Protein Sequence (338 amino acids)

>ABZR87_RS06770 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase (Ralstonia sp. UNC404CL21Col)
MRISVLGAGAWGTALASHAAQSHDVVLWGRDANLVTQMAATHINAPYLPGMTLQASLRFS
ADLQAALDHAAGDDGLAVIASPVAGLADLTRTIAAHGGVRNVIWLCKGFDPETSALPHAI
VADVLKMSGRTDLAVGVLSGPSFAKEVAQGLPCAMTVASTSEALCKLTQRGFHHHAMRVY
ASDDLVGVEVGGAVKNVLAIATGAADGLGLGLNARAALVTRGLAEMTRLGLALGGRPETF
MGLTGMGDLLLTATGDLSRNRTVGMQLAQGRPLDDILHSLGHVAEGVRCARAVAALARAK
GVDMPITFTVCEVLFEGLPAAKAVERLLQRDAKSESAR