Protein Info for ABZR87_RS06710 in Ralstonia sp. UNC404CL21Col

Annotation: glutathione synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 TIGR01380: glutathione synthase" amino acids 1 to 311 (311 residues), 408.6 bits, see alignment E=7.3e-127 PF02951: GSH-S_N" amino acids 1 to 119 (119 residues), 146.7 bits, see alignment E=4.9e-47 PF02955: GSH-S_ATP" amino acids 123 to 296 (174 residues), 235.8 bits, see alignment E=3.4e-74 PF08443: RimK" amino acids 153 to 307 (155 residues), 34.7 bits, see alignment E=2.1e-12

Best Hits

Swiss-Prot: 93% identical to GSHB_RALSO: Glutathione synthetase (gshB) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K01920, glutathione synthase [EC: 6.3.2.3] (inferred from 98% identity to rpf:Rpic12D_0220)

Predicted SEED Role

"Glutathione synthetase (EC 6.3.2.3)" in subsystem Glutathione: Biosynthesis and gamma-glutamyl cycle or Heat shock dnaK gene cluster extended (EC 6.3.2.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (323 amino acids)

>ABZR87_RS06710 glutathione synthase (Ralstonia sp. UNC404CL21Col)
MRILFIVDPLSTFKTYKDSTFAMMREAAARGYAIYTCLQSQLTLANNVVETVATPIALTG
DEHDWYRAGDARLLPLTGFDAVLMRKDPPFDMEYVTSTWLLEIAERQGARVFNKPQAIRD
HSEKLAIAQFREFTVPTIVSRDAKRLREFHAEQGDVIFKPLDGMGGAGIFRVGPDGMNLG
AVIESLTDNGARTIMAQQYIPAIREGDKRILLIGGSPVPHSLARVPMAGEVRGNLAAGGT
GKAQPLSERDHVIAHALAPVLWQRGLLLVGLDVIGDYLTEVNVTSPTCFQEITQQTGFNV
AGMFIDALERAAGKTSGLGRKPA